Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 1397358..1398466 | Replicon | chromosome |
| Accession | NZ_CP114883 | ||
| Organism | Streptococcus alactolyticus strain LGM | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | O6R09_RS07160 | Protein ID | WP_000233000.1 |
| Coordinates | 1397358..1398227 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | O6R09_RS07165 | Protein ID | WP_000205227.1 |
| Coordinates | 1398242..1398466 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R09_RS07130 (O6R09_07130) | 1392826..1393833 | - | 1008 | WP_269725562.1 | AraC family transcriptional regulator | - |
| O6R09_RS07135 (O6R09_07135) | 1393870..1394076 | - | 207 | Protein_1344 | AraC family transcriptional regulator | - |
| O6R09_RS07140 (O6R09_07140) | 1394256..1395044 | - | 789 | WP_055275145.1 | aminoglycoside nucleotidyltransferase ANT(9) | - |
| O6R09_RS07145 (O6R09_07145) | 1395176..1395703 | - | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
| O6R09_RS07150 (O6R09_07150) | 1395747..1396610 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| O6R09_RS07155 (O6R09_07155) | 1396643..1397377 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| O6R09_RS07160 (O6R09_07160) | 1397358..1398227 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| O6R09_RS07165 (O6R09_07165) | 1398242..1398466 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| O6R09_RS07170 (O6R09_07170) | 1398609..1398695 | - | 87 | Protein_1351 | site-specific recombinase | - |
| O6R09_RS07175 (O6R09_07175) | 1398904..1400186 | + | 1283 | Protein_1352 | ISL3 family transposase | - |
| O6R09_RS07180 (O6R09_07180) | 1400495..1401298 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| O6R09_RS07185 (O6R09_07185) | 1401352..1402836 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T266877 WP_000233000.1 NZ_CP114883:c1398227-1397358 [Streptococcus alactolyticus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|