Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 31601..32202 | Replicon | plasmid pLL441-1 |
| Accession | NZ_CP114875 | ||
| Organism | Lactiplantibacillus plantarum strain LL441 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | Q684P1 |
| Locus tag | O4Z47_RS14515 | Protein ID | WP_001748110.1 |
| Coordinates | 31858..32202 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | Q684P2 |
| Locus tag | O4Z47_RS14510 | Protein ID | WP_003643337.1 |
| Coordinates | 31601..31864 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4Z47_RS14475 (O4Z47_14475) | 26824..27066 | + | 243 | WP_062688575.1 | hypothetical protein | - |
| O4Z47_RS14480 (O4Z47_14480) | 27972..29075 | + | 1104 | WP_070085094.1 | replication initiator protein A | - |
| O4Z47_RS14485 (O4Z47_14485) | 29220..29444 | + | 225 | WP_070085095.1 | hypothetical protein | - |
| O4Z47_RS14490 (O4Z47_14490) | 29643..30119 | + | 477 | WP_070085096.1 | GNAT family N-acetyltransferase | - |
| O4Z47_RS14495 (O4Z47_14495) | 30153..30431 | - | 279 | WP_070085097.1 | hypothetical protein | - |
| O4Z47_RS14500 (O4Z47_14500) | 30448..30660 | - | 213 | WP_070085098.1 | hypothetical protein | - |
| O4Z47_RS14505 (O4Z47_14505) | 30928..31515 | - | 588 | WP_003646144.1 | site-specific integrase | - |
| O4Z47_RS14510 (O4Z47_14510) | 31601..31864 | + | 264 | WP_003643337.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| O4Z47_RS14515 (O4Z47_14515) | 31858..32202 | + | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O4Z47_RS14520 (O4Z47_14520) | 32323..32535 | - | 213 | WP_015063544.1 | DUF3923 family protein | - |
| O4Z47_RS14525 (O4Z47_14525) | 32774..33250 | + | 477 | WP_070084968.1 | DUF536 domain-containing protein | - |
| O4Z47_RS14530 (O4Z47_14530) | 33955..34332 | + | 378 | WP_003646093.1 | YxeA family protein | - |
| O4Z47_RS14535 (O4Z47_14535) | 34476..34937 | - | 462 | WP_269689316.1 | hypothetical protein | - |
| O4Z47_RS14540 (O4Z47_14540) | 35709..36236 | - | 528 | WP_269689317.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..55314 | 55314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T266875 WP_001748110.1 NZ_CP114875:31858-32202 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R2K1X3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6L4ZZT2 |