Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 137115..137637 | Replicon | plasmid pS245-2 |
| Accession | NZ_CP114855 | ||
| Organism | Klebsiella pneumoniae strain S245 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A7H0EVH6 |
| Locus tag | O5O52_RS27900 | Protein ID | WP_014839901.1 |
| Coordinates | 137115..137399 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A7H0EVH5 |
| Locus tag | O5O52_RS27905 | Protein ID | WP_014839900.1 |
| Coordinates | 137389..137637 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5O52_RS27865 (O5O52_27865) | 132371..132580 | + | 210 | WP_125316032.1 | hypothetical protein | - |
| O5O52_RS27870 (O5O52_27870) | 132643..133587 | + | 945 | WP_014839903.1 | DsbA family protein | - |
| O5O52_RS27875 (O5O52_27875) | 133668..134189 | + | 522 | WP_048336588.1 | hypothetical protein | - |
| O5O52_RS27880 (O5O52_27880) | 134186..134788 | + | 603 | WP_014839902.1 | HAD domain-containing protein | - |
| O5O52_RS27885 (O5O52_27885) | 135029..135748 | + | 720 | WP_042934502.1 | cation:proton antiporter | - |
| O5O52_RS27890 (O5O52_27890) | 135765..136442 | - | 678 | WP_042934501.1 | hypothetical protein | - |
| O5O52_RS27895 (O5O52_27895) | 136448..136924 | - | 477 | WP_042934526.1 | hypothetical protein | - |
| O5O52_RS27900 (O5O52_27900) | 137115..137399 | - | 285 | WP_014839901.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O5O52_RS27905 (O5O52_27905) | 137389..137637 | - | 249 | WP_014839900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O5O52_RS27910 (O5O52_27910) | 137978..139381 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| O5O52_RS27915 (O5O52_27915) | 139410..140042 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| O5O52_RS27920 (O5O52_27920) | 140586..141194 | - | 609 | WP_024266306.1 | DUF2913 family protein | - |
| O5O52_RS27925 (O5O52_27925) | 141331..141729 | - | 399 | WP_014839899.1 | H-NS family nucleoid-associated regulatory protein | - |
| O5O52_RS27930 (O5O52_27930) | 142103..142459 | - | 357 | WP_017901071.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / blaNDM-1 / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / qnrS1 / aph(3'')-Ib / sul2 / blaSFO-1 / msr(E) / mph(E) | - | 1..155225 | 155225 | |
| - | flank | IS/Tn | - | - | 137978..139381 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.46 Da Isoelectric Point: 10.5831
>T266873 WP_014839901.1 NZ_CP114855:c137399-137115 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLSERLQNPRVPAAQLHGGKDQYKIKLHGAGYRLVYSVNDEIVTVTVIGVGK
RNNDDIYNATRHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLSERLQNPRVPAAQLHGGKDQYKIKLHGAGYRLVYSVNDEIVTVTVIGVGK
RNNDDIYNATRHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H0EVH6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H0EVH5 |