Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 118306..119042 Replicon plasmid pS245-1
Accession NZ_CP114854
Organism Klebsiella pneumoniae strain S245

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag O5O52_RS26480 Protein ID WP_003026803.1
Coordinates 118560..119042 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag O5O52_RS26475 Protein ID WP_003026799.1
Coordinates 118306..118572 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5O52_RS26430 (O5O52_26430) 114368..114730 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
O5O52_RS26435 (O5O52_26435) 114780..115130 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
O5O52_RS26440 (O5O52_26440) 115488..115757 + 270 WP_004152102.1 hypothetical protein -
O5O52_RS26445 (O5O52_26445) 115745..116320 + 576 WP_004152103.1 hypothetical protein -
O5O52_RS26450 (O5O52_26450) 116351..116845 + 495 WP_004152104.1 DNA-binding protein -
O5O52_RS26455 (O5O52_26455) 116889..117257 + 369 WP_004152105.1 hypothetical protein -
O5O52_RS26460 (O5O52_26460) 117291..117494 + 204 WP_004152106.1 HHA domain-containing protein -
O5O52_RS26465 (O5O52_26465) 117543..117800 + 258 WP_004152107.1 hypothetical protein -
O5O52_RS26470 (O5O52_26470) 117876..118130 + 255 WP_004152108.1 hypothetical protein -
O5O52_RS26475 (O5O52_26475) 118306..118572 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
O5O52_RS26480 (O5O52_26480) 118560..119042 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
O5O52_RS26485 (O5O52_26485) 119250..120596 + 1347 WP_077253535.1 ISNCY family transposase -
O5O52_RS26490 (O5O52_26490) 120645..121040 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
O5O52_RS26495 (O5O52_26495) 121188..122353 - 1166 Protein_131 IS3 family transposase -
O5O52_RS26500 (O5O52_26500) 122530..123492 - 963 WP_004152113.1 zinc metalloprotease HtpX -
O5O52_RS26505 (O5O52_26505) 123479..123967 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / qnrB1 / tet(A) / aac(3)-IIa / dfrA14 - 1..249122 249122


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T266872 WP_003026803.1 NZ_CP114854:118560-119042 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT266872 WP_003026799.1 NZ_CP114854:118306-118572 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References