Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4770279..4770795 | Replicon | chromosome |
Accession | NZ_CP114853 | ||
Organism | Klebsiella pneumoniae strain S245 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | O5O52_RS23165 | Protein ID | WP_004178374.1 |
Coordinates | 4770279..4770563 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | O5O52_RS23170 | Protein ID | WP_032434351.1 |
Coordinates | 4770553..4770795 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5O52_RS23140 (4765762) | 4765762..4766025 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
O5O52_RS23145 (4766155) | 4766155..4766328 | + | 174 | WP_032414379.1 | hypothetical protein | - |
O5O52_RS23150 (4766331) | 4766331..4767074 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
O5O52_RS23155 (4767431) | 4767431..4769569 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
O5O52_RS23160 (4769811) | 4769811..4770275 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
O5O52_RS23165 (4770279) | 4770279..4770563 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O5O52_RS23170 (4770553) | 4770553..4770795 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O5O52_RS23175 (4770873) | 4770873..4772783 | - | 1911 | WP_110138999.1 | PRD domain-containing protein | - |
O5O52_RS23180 (4772806) | 4772806..4773960 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
O5O52_RS23185 (4774026) | 4774026..4774766 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T266869 WP_004178374.1 NZ_CP114853:c4770563-4770279 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|