Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4677551..4678254 | Replicon | chromosome |
Accession | NZ_CP114853 | ||
Organism | Klebsiella pneumoniae strain S245 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | O5O52_RS22770 | Protein ID | WP_071994632.1 |
Coordinates | 4677551..4677892 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | O5O52_RS22775 | Protein ID | WP_032434296.1 |
Coordinates | 4677913..4678254 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5O52_RS22760 (4673866) | 4673866..4674735 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
O5O52_RS22765 (4675326) | 4675326..4677359 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
O5O52_RS22770 (4677551) | 4677551..4677892 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
O5O52_RS22775 (4677913) | 4677913..4678254 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O5O52_RS22780 (4678265) | 4678265..4678807 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
O5O52_RS22785 (4678820) | 4678820..4679260 | - | 441 | WP_032434300.1 | antirestriction protein | - |
O5O52_RS22790 (4679291) | 4679291..4680112 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
O5O52_RS22795 (4680232) | 4680232..4680705 | - | 474 | WP_032434303.1 | hypothetical protein | - |
O5O52_RS22800 (4680777) | 4680777..4681229 | - | 453 | WP_032410767.1 | hypothetical protein | - |
O5O52_RS22805 (4681265) | 4681265..4681981 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
O5O52_RS22810 (4682225) | 4682225..4683099 | - | 875 | Protein_4470 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4665848..4711521 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T266868 WP_071994632.1 NZ_CP114853:c4677892-4677551 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|