Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4244777..4245564 | Replicon | chromosome |
| Accession | NZ_CP114853 | ||
| Organism | Klebsiella pneumoniae strain S245 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A377E3D6 |
| Locus tag | O5O52_RS20730 | Protein ID | WP_001194695.1 |
| Coordinates | 4245187..4245564 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | O5O52_RS20725 | Protein ID | WP_053266522.1 |
| Coordinates | 4244777..4245136 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5O52_RS20680 (4240015) | 4240015..4240467 | + | 453 | WP_001020418.1 | hypothetical protein | - |
| O5O52_RS20685 (4240464) | 4240464..4240916 | + | 453 | WP_000734138.1 | hypothetical protein | - |
| O5O52_RS20690 (4240979) | 4240979..4241522 | + | 544 | Protein_4060 | DUF4339 domain-containing protein | - |
| O5O52_RS20695 (4241582) | 4241582..4242034 | + | 453 | WP_001061894.1 | IrmA family protein | - |
| O5O52_RS20700 (4242111) | 4242111..4242344 | + | 234 | WP_001614358.1 | DUF905 domain-containing protein | - |
| O5O52_RS20705 (4242464) | 4242464..4243282 | + | 819 | WP_001614356.1 | DUF932 domain-containing protein | - |
| O5O52_RS20710 (4243550) | 4243550..4244020 | + | 471 | WP_000131762.1 | antirestriction protein | - |
| O5O52_RS20715 (4244032) | 4244032..4244511 | + | 480 | WP_000437750.1 | DNA repair protein RadC | - |
| O5O52_RS20720 (4244532) | 4244532..4244753 | + | 222 | WP_044068431.1 | DUF987 domain-containing protein | - |
| O5O52_RS20725 (4244777) | 4244777..4245136 | + | 360 | WP_053266522.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O5O52_RS20730 (4245187) | 4245187..4245564 | + | 378 | WP_001194695.1 | TA system toxin CbtA family protein | Toxin |
| O5O52_RS20735 (4245561) | 4245561..4246052 | + | 492 | WP_000777682.1 | DUF5983 family protein | - |
| O5O52_RS20740 (4246092) | 4246092..4246286 | + | 195 | WP_032155094.1 | DUF957 domain-containing protein | - |
| O5O52_RS20745 (4246367) | 4246367..4247211 | + | 845 | Protein_4071 | DUF4942 domain-containing protein | - |
| O5O52_RS20755 (4247555) | 4247555..4248286 | - | 732 | WP_004152034.1 | DNA polymerase III subunit epsilon | - |
| O5O52_RS20760 (4248351) | 4248351..4248818 | + | 468 | WP_002889686.1 | ribonuclease HI | - |
| O5O52_RS20765 (4248815) | 4248815..4249537 | - | 723 | WP_002889685.1 | class I SAM-dependent methyltransferase | - |
| O5O52_RS20770 (4249570) | 4249570..4250325 | + | 756 | WP_004145833.1 | hydroxyacylglutathione hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4216930..4250325 | 33395 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14180.97 Da Isoelectric Point: 7.4209
>T266866 WP_001194695.1 NZ_CP114853:4245187-4245564 [Klebsiella pneumoniae]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13109.09 Da Isoelectric Point: 7.3717
>AT266866 WP_053266522.1 NZ_CP114853:4244777-4245136 [Klebsiella pneumoniae]
MSNKTPIVNHDITEPWWGLKRSITPCFGARLVQAGNCLHYLADRASITGQFSDAVLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA
MSNKTPIVNHDITEPWWGLKRSITPCFGARLVQAGNCLHYLADRASITGQFSDAVLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|