Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4244777..4245564 Replicon chromosome
Accession NZ_CP114853
Organism Klebsiella pneumoniae strain S245

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag O5O52_RS20730 Protein ID WP_001194695.1
Coordinates 4245187..4245564 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag O5O52_RS20725 Protein ID WP_053266522.1
Coordinates 4244777..4245136 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5O52_RS20680 (4240015) 4240015..4240467 + 453 WP_001020418.1 hypothetical protein -
O5O52_RS20685 (4240464) 4240464..4240916 + 453 WP_000734138.1 hypothetical protein -
O5O52_RS20690 (4240979) 4240979..4241522 + 544 Protein_4060 DUF4339 domain-containing protein -
O5O52_RS20695 (4241582) 4241582..4242034 + 453 WP_001061894.1 IrmA family protein -
O5O52_RS20700 (4242111) 4242111..4242344 + 234 WP_001614358.1 DUF905 domain-containing protein -
O5O52_RS20705 (4242464) 4242464..4243282 + 819 WP_001614356.1 DUF932 domain-containing protein -
O5O52_RS20710 (4243550) 4243550..4244020 + 471 WP_000131762.1 antirestriction protein -
O5O52_RS20715 (4244032) 4244032..4244511 + 480 WP_000437750.1 DNA repair protein RadC -
O5O52_RS20720 (4244532) 4244532..4244753 + 222 WP_044068431.1 DUF987 domain-containing protein -
O5O52_RS20725 (4244777) 4244777..4245136 + 360 WP_053266522.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
O5O52_RS20730 (4245187) 4245187..4245564 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
O5O52_RS20735 (4245561) 4245561..4246052 + 492 WP_000777682.1 DUF5983 family protein -
O5O52_RS20740 (4246092) 4246092..4246286 + 195 WP_032155094.1 DUF957 domain-containing protein -
O5O52_RS20745 (4246367) 4246367..4247211 + 845 Protein_4071 DUF4942 domain-containing protein -
O5O52_RS20755 (4247555) 4247555..4248286 - 732 WP_004152034.1 DNA polymerase III subunit epsilon -
O5O52_RS20760 (4248351) 4248351..4248818 + 468 WP_002889686.1 ribonuclease HI -
O5O52_RS20765 (4248815) 4248815..4249537 - 723 WP_002889685.1 class I SAM-dependent methyltransferase -
O5O52_RS20770 (4249570) 4249570..4250325 + 756 WP_004145833.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4216930..4250325 33395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T266866 WP_001194695.1 NZ_CP114853:4245187-4245564 [Klebsiella pneumoniae]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13109.09 Da        Isoelectric Point: 7.3717

>AT266866 WP_053266522.1 NZ_CP114853:4244777-4245136 [Klebsiella pneumoniae]
MSNKTPIVNHDITEPWWGLKRSITPCFGARLVQAGNCLHYLADRASITGQFSDAVLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure

References