Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3973340..3973959 | Replicon | chromosome |
| Accession | NZ_CP114853 | ||
| Organism | Klebsiella pneumoniae strain S245 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | O5O52_RS19405 | Protein ID | WP_002892050.1 |
| Coordinates | 3973741..3973959 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | O5O52_RS19400 | Protein ID | WP_002892066.1 |
| Coordinates | 3973340..3973714 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5O52_RS19390 (3968492) | 3968492..3969685 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| O5O52_RS19395 (3969708) | 3969708..3972854 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| O5O52_RS19400 (3973340) | 3973340..3973714 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| O5O52_RS19405 (3973741) | 3973741..3973959 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| O5O52_RS19410 (3974118) | 3974118..3974684 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| O5O52_RS19415 (3974656) | 3974656..3974796 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| O5O52_RS19420 (3974817) | 3974817..3975287 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| O5O52_RS19425 (3975262) | 3975262..3976713 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
| O5O52_RS19430 (3976814) | 3976814..3977512 | + | 699 | WP_032435564.1 | GNAT family protein | - |
| O5O52_RS19435 (3977509) | 3977509..3977649 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| O5O52_RS19440 (3977649) | 3977649..3977912 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T266865 WP_002892050.1 NZ_CP114853:3973741-3973959 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT266865 WP_002892066.1 NZ_CP114853:3973340-3973714 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |