Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3973340..3973959 Replicon chromosome
Accession NZ_CP114853
Organism Klebsiella pneumoniae strain S245

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag O5O52_RS19405 Protein ID WP_002892050.1
Coordinates 3973741..3973959 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag O5O52_RS19400 Protein ID WP_002892066.1
Coordinates 3973340..3973714 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5O52_RS19390 (3968492) 3968492..3969685 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
O5O52_RS19395 (3969708) 3969708..3972854 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
O5O52_RS19400 (3973340) 3973340..3973714 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
O5O52_RS19405 (3973741) 3973741..3973959 + 219 WP_002892050.1 HHA domain-containing protein Toxin
O5O52_RS19410 (3974118) 3974118..3974684 + 567 WP_002892030.1 maltose O-acetyltransferase -
O5O52_RS19415 (3974656) 3974656..3974796 - 141 WP_004147370.1 hypothetical protein -
O5O52_RS19420 (3974817) 3974817..3975287 + 471 WP_002892026.1 YlaC family protein -
O5O52_RS19425 (3975262) 3975262..3976713 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
O5O52_RS19430 (3976814) 3976814..3977512 + 699 WP_032435564.1 GNAT family protein -
O5O52_RS19435 (3977509) 3977509..3977649 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
O5O52_RS19440 (3977649) 3977649..3977912 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T266865 WP_002892050.1 NZ_CP114853:3973741-3973959 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT266865 WP_002892066.1 NZ_CP114853:3973340-3973714 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References