Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4742496..4743112 Replicon chromosome
Accession NZ_CP114801
Organism Citrobacter sp. 21OH12SH02A-Citro

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag O6D90_RS22780 Protein ID WP_016155182.1
Coordinates 4742496..4742870 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID R8WIS4
Locus tag O6D90_RS22785 Protein ID WP_016155181.1
Coordinates 4742870..4743112 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6D90_RS22765 (4739999) 4739999..4740901 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
O6D90_RS22770 (4740898) 4740898..4741533 + 636 WP_003028686.1 formate dehydrogenase cytochrome b556 subunit -
O6D90_RS22775 (4741530) 4741530..4742459 + 930 WP_003028685.1 formate dehydrogenase accessory protein FdhE -
O6D90_RS22780 (4742496) 4742496..4742870 - 375 WP_016155182.1 type II toxin-antitoxin system VapC family toxin Toxin
O6D90_RS22785 (4742870) 4742870..4743112 - 243 WP_016155181.1 CopG family transcriptional regulator Antitoxin
O6D90_RS22790 (4743318) 4743318..4744226 + 909 Protein_4452 alpha/beta hydrolase -
O6D90_RS22795 (4744291) 4744291..4744533 + 243 WP_016155179.1 type II toxin-antitoxin system ParD family antitoxin -
O6D90_RS22800 (4744526) 4744526..4744813 + 288 WP_016157876.1 type II toxin-antitoxin system RelE/ParE family toxin -
O6D90_RS22805 (4744819) 4744819..4745760 - 942 WP_003825286.1 fatty acid biosynthesis protein FabY -
O6D90_RS22810 (4745805) 4745805..4746242 - 438 WP_016157874.1 D-aminoacyl-tRNA deacylase -
O6D90_RS22815 (4746239) 4746239..4747111 - 873 WP_019077938.1 virulence factor BrkB family protein -
O6D90_RS22820 (4747105) 4747105..4747704 - 600 WP_016157873.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-113)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13678.84 Da        Isoelectric Point: 8.5373

>T266853 WP_016155182.1 NZ_CP114801:c4742870-4742496 [Citrobacter sp. 21OH12SH02A-Citro]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.72 Da        Isoelectric Point: 4.3331

>AT266853 WP_016155181.1 NZ_CP114801:c4743112-4742870 [Citrobacter sp. 21OH12SH02A-Citro]
MMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVEQYLERQDQAETTISRALGLWQGCEEDGVDYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB R8WIS4

References