Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4742496..4743112 | Replicon | chromosome |
| Accession | NZ_CP114801 | ||
| Organism | Citrobacter sp. 21OH12SH02A-Citro | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O6D90_RS22780 | Protein ID | WP_016155182.1 |
| Coordinates | 4742496..4742870 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | R8WIS4 |
| Locus tag | O6D90_RS22785 | Protein ID | WP_016155181.1 |
| Coordinates | 4742870..4743112 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6D90_RS22765 | 4739999..4740901 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| O6D90_RS22770 | 4740898..4741533 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| O6D90_RS22775 | 4741530..4742459 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| O6D90_RS22780 | 4742496..4742870 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O6D90_RS22785 | 4742870..4743112 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | Antitoxin |
| O6D90_RS22790 | 4743318..4744226 | + | 909 | Protein_4452 | alpha/beta hydrolase | - |
| O6D90_RS22795 | 4744291..4744533 | + | 243 | WP_016155179.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| O6D90_RS22800 | 4744526..4744813 | + | 288 | WP_016157876.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O6D90_RS22805 | 4744819..4745760 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| O6D90_RS22810 | 4745805..4746242 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
| O6D90_RS22815 | 4746239..4747111 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| O6D90_RS22820 | 4747105..4747704 | - | 600 | WP_016157873.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13678.84 Da Isoelectric Point: 8.5373
>T266853 WP_016155182.1 NZ_CP114801:c4742870-4742496 [Citrobacter sp. 21OH12SH02A-Citro]
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
MVTGSALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMELMVGAKKYHQESRTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTRDFAGISGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|