Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 4306778..4307297 | Replicon | chromosome |
Accession | NZ_CP114801 | ||
Organism | Citrobacter sp. 21OH12SH02A-Citro |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O6D90_RS20770 | Protein ID | WP_016155559.1 |
Coordinates | 4306778..4307059 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0V9JX71 |
Locus tag | O6D90_RS20775 | Protein ID | WP_016155558.1 |
Coordinates | 4307049..4307297 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6D90_RS20755 (4303782) | 4303782..4304246 | + | 465 | WP_016155562.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
O6D90_RS20760 (4304265) | 4304265..4304786 | - | 522 | WP_016155561.1 | hypothetical protein | - |
O6D90_RS20765 (4304786) | 4304786..4306750 | - | 1965 | WP_016155560.1 | type VI secretion system tip protein TssI/VgrG | - |
O6D90_RS20770 (4306778) | 4306778..4307059 | - | 282 | WP_016155559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O6D90_RS20775 (4307049) | 4307049..4307297 | - | 249 | WP_016155558.1 | hypothetical protein | Antitoxin |
O6D90_RS20780 (4307395) | 4307395..4307523 | - | 129 | WP_016155557.1 | hypothetical protein | - |
O6D90_RS20785 (4307592) | 4307592..4308065 | - | 474 | WP_016155556.1 | hypothetical protein | - |
O6D90_RS20790 (4308108) | 4308108..4310609 | - | 2502 | WP_016155555.1 | type VI secretion system ATPase TssH | - |
O6D90_RS20795 (4310600) | 4310600..4311547 | - | 948 | WP_016155554.1 | type VI secretion system baseplate subunit TssG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11004.76 Da Isoelectric Point: 10.4466
>T266852 WP_016155559.1 NZ_CP114801:c4307059-4306778 [Citrobacter sp. 21OH12SH02A-Citro]
MTYNLEFLDVALKEWRKLSPTLREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
MTYNLEFLDVALKEWRKLSPTLREQFKKKLAERLENPHVPAARLSGKLHRYKIKLRSAGYRLVYQVEDEQVVVLVIAVGR
RDGDEVYHQANRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|