Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4186308..4186884 | Replicon | chromosome |
| Accession | NZ_CP114801 | ||
| Organism | Citrobacter sp. 21OH12SH02A-Citro | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A8I0KMP7 |
| Locus tag | O6D90_RS20220 | Protein ID | WP_016155613.1 |
| Coordinates | 4186597..4186884 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A2I8S1U6 |
| Locus tag | O6D90_RS20215 | Protein ID | WP_016155614.1 |
| Coordinates | 4186308..4186610 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6D90_RS20200 (4182810) | 4182810..4183004 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
| O6D90_RS20205 (4183017) | 4183017..4183973 | + | 957 | WP_016155616.1 | GTPase | - |
| O6D90_RS20210 (4184160) | 4184160..4186007 | + | 1848 | WP_016155615.1 | 3'-5' exonuclease | - |
| O6D90_RS20215 (4186308) | 4186308..4186610 | - | 303 | WP_016155614.1 | BrnA antitoxin family protein | Antitoxin |
| O6D90_RS20220 (4186597) | 4186597..4186884 | - | 288 | WP_016155613.1 | BrnT family toxin | Toxin |
| O6D90_RS20225 (4187119) | 4187119..4188285 | + | 1167 | WP_019078303.1 | restriction endonuclease | - |
| O6D90_RS20230 (4188381) | 4188381..4188527 | + | 147 | Protein_3961 | type I restriction endonuclease subunit R | - |
| O6D90_RS20235 (4188514) | 4188514..4188774 | + | 261 | Protein_3962 | endoribonuclease SymE | - |
| O6D90_RS20240 (4188869) | 4188869..4189360 | - | 492 | WP_016151575.1 | type VI secretion system tube protein TssD | - |
| O6D90_RS20245 (4189599) | 4189599..4189868 | - | 270 | WP_271143192.1 | hypothetical protein | - |
| O6D90_RS20250 (4189868) | 4189868..4190299 | - | 432 | WP_225836832.1 | DUF2778 domain-containing protein | - |
| O6D90_RS20255 (4190457) | 4190457..4190627 | - | 171 | Protein_3966 | hypothetical protein | - |
| O6D90_RS20260 (4190633) | 4190633..4191087 | - | 455 | Protein_3967 | MarR family transcriptional regulator | - |
| O6D90_RS20265 (4191236) | 4191236..4191400 | - | 165 | WP_016155606.1 | DUF1127 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11310.75 Da Isoelectric Point: 7.4687
>T266851 WP_016155613.1 NZ_CP114801:c4186884-4186597 [Citrobacter sp. 21OH12SH02A-Citro]
MPMEFEWDANKAQSNLRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
MPMEFEWDANKAQSNLRKHGVRFEDAILVFDDPQHLSRQERYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|