Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3842611..3843290 | Replicon | chromosome |
Accession | NZ_CP114801 | ||
Organism | Citrobacter sp. 21OH12SH02A-Citro |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | O6D90_RS18640 | Protein ID | WP_016246873.1 |
Coordinates | 3842949..3843290 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | O6D90_RS18635 | Protein ID | WP_113372912.1 |
Coordinates | 3842611..3842928 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6D90_RS18600 (3838389) | 3838389..3839150 | + | 762 | WP_127790460.1 | hypothetical protein | - |
O6D90_RS18605 (3839272) | 3839272..3840135 | + | 864 | WP_113372766.1 | GTPase family protein | - |
O6D90_RS18610 (3840224) | 3840224..3841045 | + | 822 | WP_113372767.1 | DUF932 domain-containing protein | - |
O6D90_RS18615 (3841069) | 3841069..3841308 | + | 240 | WP_007869725.1 | DUF905 domain-containing protein | - |
O6D90_RS18620 (3841412) | 3841412..3841870 | + | 459 | WP_113372854.1 | antirestriction protein | - |
O6D90_RS18625 (3841886) | 3841886..3842362 | + | 477 | WP_000811693.1 | RadC family protein | - |
O6D90_RS18630 (3842371) | 3842371..3842592 | + | 222 | WP_063841895.1 | DUF987 domain-containing protein | - |
O6D90_RS18635 (3842611) | 3842611..3842928 | + | 318 | WP_113372912.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O6D90_RS18640 (3842949) | 3842949..3843290 | + | 342 | WP_016246873.1 | TA system toxin CbtA family protein | Toxin |
O6D90_RS18650 (3843913) | 3843913..3844377 | - | 465 | WP_016155776.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
O6D90_RS18655 (3844571) | 3844571..3846019 | - | 1449 | WP_016155775.1 | EAL domain-containing protein | - |
O6D90_RS18660 (3846362) | 3846362..3846835 | - | 474 | WP_016155774.1 | hypothetical protein | - |
O6D90_RS18665 (3846810) | 3846810..3847541 | - | 732 | WP_016155773.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3801908..3853227 | 51319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12987.05 Da Isoelectric Point: 10.2764
>T266850 WP_016246873.1 NZ_CP114801:3842949-3843290 [Citrobacter sp. 21OH12SH02A-Citro]
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11847.42 Da Isoelectric Point: 6.7339
>AT266850 WP_113372912.1 NZ_CP114801:3842611-3842928 [Citrobacter sp. 21OH12SH02A-Citro]
MSNITWGLQRDITPRLGARLVQEGNRLHYLADRASITGKFSDVECRKLDETCPHFIRHMESMLTTGELSPQHAHCVTLYH
NGFTCEADTLGSCGYVYIAIYPTQS
MSNITWGLQRDITPRLGARLVQEGNRLHYLADRASITGKFSDVECRKLDETCPHFIRHMESMLTTGELSPQHAHCVTLYH
NGFTCEADTLGSCGYVYIAIYPTQS
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|