Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2347115..2347751 | Replicon | chromosome |
| Accession | NZ_CP114801 | ||
| Organism | Citrobacter sp. 21OH12SH02A-Citro | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2I8S6E9 |
| Locus tag | O6D90_RS11380 | Protein ID | WP_049259794.1 |
| Coordinates | 2347115..2347303 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O6D90_RS11385 | Protein ID | WP_131382557.1 |
| Coordinates | 2347335..2347751 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6D90_RS11360 (2343893) | 2343893..2344123 | - | 231 | WP_016156585.1 | DUF2554 family protein | - |
| O6D90_RS11365 (2344313) | 2344313..2344438 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| O6D90_RS11370 (2344438) | 2344438..2345448 | - | 1011 | WP_016153157.1 | cytochrome d ubiquinol oxidase subunit II | - |
| O6D90_RS11375 (2345448) | 2345448..2346851 | - | 1404 | WP_016153156.1 | cytochrome ubiquinol oxidase subunit I | - |
| O6D90_RS11380 (2347115) | 2347115..2347303 | + | 189 | WP_049259794.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| O6D90_RS11385 (2347335) | 2347335..2347751 | + | 417 | WP_131382557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| O6D90_RS11390 (2347844) | 2347844..2349253 | + | 1410 | WP_016156583.1 | PLP-dependent aminotransferase family protein | - |
| O6D90_RS11395 (2349583) | 2349583..2350728 | + | 1146 | WP_137379725.1 | ABC transporter substrate-binding protein | - |
| O6D90_RS11400 (2350745) | 2350745..2351761 | + | 1017 | WP_016156582.1 | ABC transporter ATP-binding protein | - |
| O6D90_RS11405 (2351762) | 2351762..2352706 | + | 945 | WP_016153152.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7102.16 Da Isoelectric Point: 11.5775
>T266844 WP_049259794.1 NZ_CP114801:2347115-2347303 [Citrobacter sp. 21OH12SH02A-Citro]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKSILKQLGLQSSSI
Download Length: 189 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15064.33 Da Isoelectric Point: 4.7119
>AT266844 WP_131382557.1 NZ_CP114801:2347335-2347751 [Citrobacter sp. 21OH12SH02A-Citro]
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
MRYPVNLIPAVEGGFVVSFPDIPEALTQGETRHGALQAAQSALVTAFEFYFDDNEPIPLPSAVGTEGDYVEIPLSIASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHATKIDAVQIAARALGKELSVTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|