Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 851538..852192 | Replicon | chromosome |
Accession | NZ_CP114801 | ||
Organism | Citrobacter sp. 21OH12SH02A-Citro |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R8WN60 |
Locus tag | O6D90_RS04195 | Protein ID | WP_016154348.1 |
Coordinates | 851785..852192 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8WMJ6 |
Locus tag | O6D90_RS04190 | Protein ID | WP_016154349.1 |
Coordinates | 851538..851804 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6D90_RS04165 (846751) | 846751..848184 | - | 1434 | WP_016154353.1 | 6-phospho-beta-glucosidase BglA | - |
O6D90_RS04170 (848305) | 848305..849033 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
O6D90_RS04175 (849086) | 849086..849397 | + | 312 | WP_016154352.1 | N(4)-acetylcytidine aminohydrolase | - |
O6D90_RS04180 (849561) | 849561..850220 | + | 660 | WP_016154351.1 | hemolysin III family protein | - |
O6D90_RS04185 (850300) | 850300..851280 | - | 981 | WP_016157415.1 | tRNA-modifying protein YgfZ | - |
O6D90_RS04190 (851538) | 851538..851804 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
O6D90_RS04195 (851785) | 851785..852192 | + | 408 | WP_016154348.1 | protein YgfX | Toxin |
O6D90_RS04200 (852293) | 852293..852814 | - | 522 | WP_016157414.1 | flavodoxin FldB | - |
O6D90_RS04205 (852928) | 852928..853824 | + | 897 | WP_016154346.1 | site-specific tyrosine recombinase XerD | - |
O6D90_RS04210 (853848) | 853848..854561 | + | 714 | WP_016154345.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O6D90_RS04215 (854567) | 854567..856300 | + | 1734 | WP_016157413.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15850.66 Da Isoelectric Point: 11.2845
>T266843 WP_016154348.1 NZ_CP114801:851785-852192 [Citrobacter sp. 21OH12SH02A-Citro]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIASAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLILQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|