Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 29260..29837 | Replicon | plasmid p21OH12SH02B-2 |
Accession | NZ_CP114798 | ||
Organism | Providencia sp. 21OH12SH02B-Prov |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U5N651 |
Locus tag | O7C57_RS21175 | Protein ID | WP_023159957.1 |
Coordinates | 29260..29592 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | O7C57_RS21180 | Protein ID | WP_096864992.1 |
Coordinates | 29592..29837 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O7C57_RS21150 (O7C57_21150) | 25270..26085 | - | 816 | WP_269724013.1 | DUF4365 domain-containing protein | - |
O7C57_RS21155 (O7C57_21155) | 26101..27054 | - | 954 | WP_269724014.1 | site-specific integrase | - |
O7C57_RS21160 (O7C57_21160) | 27458..28255 | + | 798 | WP_048607643.1 | hypothetical protein | - |
O7C57_RS21165 (O7C57_21165) | 28620..28763 | + | 144 | WP_071547955.1 | Hok/Gef family protein | - |
O7C57_RS21170 (O7C57_21170) | 28849..29229 | - | 381 | WP_096864991.1 | hypothetical protein | - |
O7C57_RS21175 (O7C57_21175) | 29260..29592 | - | 333 | WP_023159957.1 | endoribonuclease MazF | Toxin |
O7C57_RS21180 (O7C57_21180) | 29592..29837 | - | 246 | WP_096864992.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
O7C57_RS21185 (O7C57_21185) | 30107..30730 | + | 624 | WP_109910889.1 | AAA family ATPase | - |
O7C57_RS21190 (O7C57_21190) | 30831..31058 | + | 228 | WP_096864993.1 | plasmid partition protein ParG | - |
O7C57_RS21195 (O7C57_21195) | 31156..31524 | - | 369 | WP_109910890.1 | hypothetical protein | - |
O7C57_RS21200 (O7C57_21200) | 31757..32266 | - | 510 | WP_282559889.1 | hypothetical protein | - |
O7C57_RS21205 (O7C57_21205) | 32276..32698 | - | 423 | WP_048821775.1 | hypothetical protein | - |
O7C57_RS21210 (O7C57_21210) | 32691..33035 | - | 345 | WP_023159966.1 | single-stranded DNA-binding protein | - |
O7C57_RS21215 (O7C57_21215) | 33038..34084 | - | 1047 | WP_072070749.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..43629 | 43629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12097.88 Da Isoelectric Point: 7.0813
>T266841 WP_023159957.1 NZ_CP114798:c29592-29260 [Providencia sp. 21OH12SH02B-Prov]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|