Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3553370..3554020 | Replicon | chromosome |
Accession | NZ_CP114796 | ||
Organism | Providencia sp. 21OH12SH02B-Prov |
Toxin (Protein)
Gene name | Hha | Uniprot ID | K8W3H1 |
Locus tag | O7C57_RS16515 | Protein ID | WP_004927064.1 |
Coordinates | 3553817..3554020 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | O7C57_RS16510 | Protein ID | WP_154635730.1 |
Coordinates | 3553370..3553738 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O7C57_RS16485 (O7C57_16485) | 3548513..3549274 | - | 762 | WP_269723356.1 | DNA polymerase III subunit epsilon | - |
O7C57_RS16490 (O7C57_16490) | 3549329..3549799 | + | 471 | WP_154624044.1 | ribonuclease HI | - |
O7C57_RS16495 (O7C57_16495) | 3549866..3550591 | - | 726 | WP_154624043.1 | methyltransferase domain-containing protein | - |
O7C57_RS16500 (O7C57_16500) | 3550631..3551386 | + | 756 | WP_269723357.1 | hydroxyacylglutathione hydrolase | - |
O7C57_RS16505 (O7C57_16505) | 3551465..3552802 | + | 1338 | WP_154624041.1 | murein transglycosylase D | - |
O7C57_RS16510 (O7C57_16510) | 3553370..3553738 | + | 369 | WP_154635730.1 | Hha toxicity modulator TomB | Antitoxin |
O7C57_RS16515 (O7C57_16515) | 3553817..3554020 | + | 204 | WP_004927064.1 | HHA domain-containing protein | Toxin |
O7C57_RS16525 (O7C57_16525) | 3554630..3555088 | - | 459 | WP_196713815.1 | YbaY family lipoprotein | - |
O7C57_RS16530 (O7C57_16530) | 3555413..3556279 | + | 867 | WP_154622395.1 | acyl-CoA thioesterase II | - |
O7C57_RS16535 (O7C57_16535) | 3556507..3557790 | - | 1284 | WP_154622396.1 | ammonium transporter AmtB | - |
O7C57_RS16540 (O7C57_16540) | 3557801..3558139 | - | 339 | WP_154622397.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8075.37 Da Isoelectric Point: 6.9770
>T266840 WP_004927064.1 NZ_CP114796:3553817-3554020 [Providencia sp. 21OH12SH02B-Prov]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14106.92 Da Isoelectric Point: 4.3486
>AT266840 WP_154635730.1 NZ_CP114796:3553370-3553738 [Providencia sp. 21OH12SH02B-Prov]
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|