Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 4417096..4417913 | Replicon | chromosome |
Accession | NZ_CP114791 | ||
Organism | Sphingomonas sp. NIBR02145 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | O3305_RS20305 | Protein ID | WP_269574157.1 |
Coordinates | 4417371..4417913 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | O3305_RS20300 | Protein ID | WP_269574156.1 |
Coordinates | 4417096..4417380 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3305_RS20260 (O3305_20260) | 4412147..4412611 | - | 465 | WP_269574148.1 | DoxX family protein | - |
O3305_RS20265 (O3305_20265) | 4412672..4412950 | - | 279 | WP_269574149.1 | DUF2282 domain-containing protein | - |
O3305_RS20270 (O3305_20270) | 4413162..4413701 | + | 540 | WP_269574150.1 | sigma-70 family RNA polymerase sigma factor | - |
O3305_RS20275 (O3305_20275) | 4413698..4414339 | + | 642 | WP_269574151.1 | DUF1109 domain-containing protein | - |
O3305_RS20280 (O3305_20280) | 4414423..4414695 | + | 273 | WP_269574152.1 | hypothetical protein | - |
O3305_RS20285 (O3305_20285) | 4414760..4415590 | + | 831 | WP_269574153.1 | DUF692 domain-containing protein | - |
O3305_RS20290 (O3305_20290) | 4415587..4416378 | + | 792 | WP_269574154.1 | DNA-binding domain-containing protein | - |
O3305_RS20295 (O3305_20295) | 4416589..4416786 | + | 198 | WP_269574155.1 | hypothetical protein | - |
O3305_RS20300 (O3305_20300) | 4417096..4417380 | + | 285 | WP_269574156.1 | DUF1778 domain-containing protein | Antitoxin |
O3305_RS20305 (O3305_20305) | 4417371..4417913 | + | 543 | WP_269574157.1 | GNAT family N-acetyltransferase | Toxin |
O3305_RS20310 (O3305_20310) | 4418585..4419025 | - | 441 | WP_269574158.1 | hypothetical protein | - |
O3305_RS20315 (O3305_20315) | 4419052..4421424 | - | 2373 | WP_269574159.1 | TonB-dependent receptor | - |
O3305_RS20320 (O3305_20320) | 4421429..4422418 | - | 990 | WP_269574160.1 | FecR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4260006..4418757 | 158751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19474.39 Da Isoelectric Point: 8.8224
>T266838 WP_269574157.1 NZ_CP114791:4417371-4417913 [Sphingomonas sp. NIBR02145]
MGVIEPLGAPRPAYAAPTPITADHRLDGFECGKPPLDSWLKTHALDNEGKASRTYVVDARLGEDAGNVVAYYTLAFGSVT
REEVPKKIRQGLPNPVPVMVLGRLAVDKRHAGKGLGPALLREALQRTAEASRIGGLRALIVHAIDDDAVSFYTKYGFQIF
PAGSRTLFLPIETVRQSIVE
MGVIEPLGAPRPAYAAPTPITADHRLDGFECGKPPLDSWLKTHALDNEGKASRTYVVDARLGEDAGNVVAYYTLAFGSVT
REEVPKKIRQGLPNPVPVMVLGRLAVDKRHAGKGLGPALLREALQRTAEASRIGGLRALIVHAIDDDAVSFYTKYGFQIF
PAGSRTLFLPIETVRQSIVE
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|