Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2705539..2705987 Replicon chromosome
Accession NZ_CP114791
Organism Sphingomonas sp. NIBR02145

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag O3305_RS11925 Protein ID WP_269572768.1
Coordinates 2705715..2705987 (+) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag O3305_RS11920 Protein ID WP_269572767.1
Coordinates 2705539..2705715 (+) Length 59 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3305_RS11905 (O3305_11905) 2703536..2704216 - 681 WP_269572764.1 DUF4918 family protein -
O3305_RS11910 (O3305_11910) 2704295..2704942 + 648 WP_269572765.1 hypothetical protein -
O3305_RS11915 (O3305_11915) 2704905..2705297 - 393 WP_269572766.1 hypothetical protein -
O3305_RS11920 (O3305_11920) 2705539..2705715 + 177 WP_269572767.1 stability determinant Antitoxin
O3305_RS11925 (O3305_11925) 2705715..2705987 + 273 WP_269572768.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O3305_RS11930 (O3305_11930) 2706196..2707302 + 1107 WP_269572769.1 hypothetical protein -
O3305_RS11935 (O3305_11935) 2707287..2707733 + 447 WP_269572770.1 hypothetical protein -
O3305_RS11940 (O3305_11940) 2707914..2708126 + 213 WP_184169071.1 cold-shock protein -
O3305_RS11945 (O3305_11945) 2708225..2708434 + 210 WP_184169072.1 hypothetical protein -
O3305_RS11950 (O3305_11950) 2708431..2708586 + 156 WP_269572771.1 hypothetical protein -
O3305_RS11955 (O3305_11955) 2708769..2709302 + 534 WP_269572772.1 DUF3617 domain-containing protein -
O3305_RS11960 (O3305_11960) 2709395..2709799 + 405 WP_269572773.1 hypothetical protein -
O3305_RS11965 (O3305_11965) 2709867..2710271 + 405 WP_184169076.1 glycine zipper 2TM domain-containing protein -
O3305_RS11970 (O3305_11970) 2710349..2710774 + 426 WP_184169077.1 OsmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2704295..2712338 8043


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10247.74 Da        Isoelectric Point: 6.7581

>T266837 WP_269572768.1 NZ_CP114791:2705715-2705987 [Sphingomonas sp. NIBR02145]
MLPHLWHPEALEDLETVIDFIEARNPSAARRIGDAIRSTADQLPAHSHAYRPGRVPGTREAVVHPNYILIYRVAEIIEVM
AVFHARQLYP

Download         Length: 273 bp

Antitoxin


Download         Length: 59 a.a.        Molecular weight: 6557.39 Da        Isoelectric Point: 4.5318

>AT266837 WP_269572767.1 NZ_CP114791:2705539-2705715 [Sphingomonas sp. NIBR02145]
MAKLSPIVSEFASTEEEEAYDAWFRAKVEARLADKAPGIPHEEVMARMQAILDRHAQD

Download         Length: 177 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References