Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 13578..14224 | Replicon | plasmid unnamed3 |
Accession | NZ_CP114789 | ||
Organism | Roseibium sp. Sym1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O6760_RS32405 | Protein ID | WP_062492135.1 |
Coordinates | 13817..14224 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O6760_RS32400 | Protein ID | WP_082809967.1 |
Coordinates | 13578..13820 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6760_RS32385 | 9785..10978 | + | 1194 | WP_088665297.1 | plasmid partitioning protein RepA | - |
O6760_RS32390 | 10982..11983 | + | 1002 | WP_152508057.1 | plasmid partitioning protein RepB | - |
O6760_RS32395 | 12207..13463 | + | 1257 | WP_062492133.1 | plasmid replication protein RepC | - |
O6760_RS32400 | 13578..13820 | + | 243 | WP_082809967.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O6760_RS32405 | 13817..14224 | + | 408 | WP_062492135.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O6760_RS32410 | 14449..14655 | + | 207 | WP_062492137.1 | antitoxin VbhA family protein | - |
O6760_RS32415 | 14720..15610 | + | 891 | Protein_17 | Fic family protein | - |
O6760_RS32420 | 15707..16438 | + | 732 | WP_228148177.1 | BID domain-containing protein | - |
O6760_RS32425 | 16714..17058 | + | 345 | WP_062492226.1 | DUF736 family protein | - |
O6760_RS32430 | 17363..17650 | + | 288 | WP_062492139.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..120881 | 120881 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15120.26 Da Isoelectric Point: 5.2058
>T266835 WP_062492135.1 NZ_CP114789:13817-14224 [Roseibium sp. Sym1]
MIYVLDTNVITAARRAERAPKVAAWLSDKPEETLYVSVVTLGEIERGIRLQERRNMDFAKHLRQWLDRTVSMFGDRLLEF
TASDALCWGELSARIGHNGADLMIAAQALTRNGWVVTGNASDFEPTGVQLVDPFV
MIYVLDTNVITAARRAERAPKVAAWLSDKPEETLYVSVVTLGEIERGIRLQERRNMDFAKHLRQWLDRTVSMFGDRLLEF
TASDALCWGELSARIGHNGADLMIAAQALTRNGWVVTGNASDFEPTGVQLVDPFV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|