Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 68812..69548 | Replicon | plasmid p3045-2 |
| Accession | NZ_CP114774 | ||
| Organism | Raoultella planticola strain RP_3045 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | O4J57_RS28945 | Protein ID | WP_003026803.1 |
| Coordinates | 68812..69294 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | O4J57_RS28950 | Protein ID | WP_003026799.1 |
| Coordinates | 69282..69548 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4J57_RS28925 (O4J57_28920) | 64679..64810 | - | 132 | WP_004218042.1 | hypothetical protein | - |
| O4J57_RS28930 (O4J57_28925) | 64971..66317 | - | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| O4J57_RS28935 (O4J57_28930) | 66547..67179 | + | 633 | WP_001567369.1 | hypothetical protein | - |
| O4J57_RS28940 (O4J57_28935) | 67208..68611 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| O4J57_RS28945 (O4J57_28940) | 68812..69294 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| O4J57_RS28950 (O4J57_28945) | 69282..69548 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| O4J57_RS28955 (O4J57_28950) | 69818..70606 | + | 789 | WP_077255422.1 | hypothetical protein | - |
| O4J57_RS28960 (O4J57_28955) | 70552..71256 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| O4J57_RS28965 (O4J57_28960) | 71330..71596 | + | 267 | WP_102047566.1 | ArsA-related P-loop ATPase | - |
| O4J57_RS28970 (O4J57_28965) | 71627..72052 | - | 426 | WP_000065758.1 | glutaredoxin-dependent arsenate reductase | - |
| O4J57_RS28975 (O4J57_28970) | 72065..73354 | - | 1290 | WP_000922630.1 | arsenite efflux transporter membrane subunit ArsB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..212569 | 212569 | |
| - | inside | IScluster/Tn | - | - | 62622..71256 | 8634 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T266831 WP_003026803.1 NZ_CP114774:c69294-68812 [Raoultella planticola]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |