Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 227143..227665 | Replicon | plasmid p3045-1 |
Accession | NZ_CP114773 | ||
Organism | Raoultella planticola strain RP_3045 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A7H0EVH6 |
Locus tag | O4J57_RS28415 | Protein ID | WP_014839901.1 |
Coordinates | 227381..227665 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A7H0EVH5 |
Locus tag | O4J57_RS28410 | Protein ID | WP_014839900.1 |
Coordinates | 227143..227391 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4J57_RS28400 (O4J57_28395) | 224273..225028 | - | 756 | WP_100757158.1 | hypothetical protein | - |
O4J57_RS28405 (O4J57_28400) | 225021..226265 | - | 1245 | WP_124053351.1 | hypothetical protein | - |
O4J57_RS28410 (O4J57_28405) | 227143..227391 | + | 249 | WP_014839900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O4J57_RS28415 (O4J57_28410) | 227381..227665 | + | 285 | WP_014839901.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4J57_RS28420 (O4J57_28415) | 227856..228332 | + | 477 | WP_042934526.1 | hypothetical protein | - |
O4J57_RS28425 (O4J57_28420) | 228338..229015 | + | 678 | WP_042934501.1 | hypothetical protein | - |
O4J57_RS28430 (O4J57_28425) | 229032..229373 | - | 342 | WP_233430673.1 | DUF2807 domain-containing protein | - |
O4J57_RS28435 (O4J57_28430) | 229356..229751 | - | 396 | Protein_250 | cation:proton antiporter | - |
O4J57_RS28440 (O4J57_28435) | 229992..230594 | - | 603 | WP_014839902.1 | HAD domain-containing protein | - |
O4J57_RS28445 (O4J57_28440) | 230591..231112 | - | 522 | WP_048336588.1 | hypothetical protein | - |
O4J57_RS28450 (O4J57_28445) | 231193..232137 | - | 945 | WP_014839903.1 | DsbA family protein | - |
O4J57_RS28455 (O4J57_28450) | 232200..232409 | - | 210 | WP_125316032.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | fosA3 / blaSHV-12 / sul2 / aph(3'')-Ib / aph(6)-Id / qnrS1 / catA2 / aac(3)-IId / sul1 / qacE / blaIMP-4 | - | 1..260053 | 260053 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.46 Da Isoelectric Point: 10.5831
>T266830 WP_014839901.1 NZ_CP114773:227381-227665 [Raoultella planticola]
MTYKLAFNESALKEWKKLGHTIREQFKKKLSERLQNPRVPAAQLHGGKDQYKIKLHGAGYRLVYSVNDEIVTVTVIGVGK
RNNDDIYNATRHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLSERLQNPRVPAAQLHGGKDQYKIKLHGAGYRLVYSVNDEIVTVTVIGVGK
RNNDDIYNATRHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H0EVH6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H0EVH5 |