Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4995139..4995718 | Replicon | chromosome |
Accession | NZ_CP114772 | ||
Organism | Raoultella planticola strain RP_3045 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | O4J57_RS23730 | Protein ID | WP_278071913.1 |
Coordinates | 4995431..4995718 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A485AW76 |
Locus tag | O4J57_RS23725 | Protein ID | WP_032689635.1 |
Coordinates | 4995139..4995444 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4J57_RS23700 (O4J57_23695) | 4990348..4991412 | - | 1065 | WP_278071910.1 | DUF2955 domain-containing protein | - |
O4J57_RS23705 (O4J57_23700) | 4991402..4992469 | - | 1068 | WP_032689633.1 | HlyD family secretion protein | - |
O4J57_RS23710 (O4J57_23705) | 4992476..4992940 | - | 465 | WP_032689634.1 | MarR family transcriptional regulator | - |
O4J57_RS23715 (O4J57_23710) | 4993231..4993395 | - | 165 | WP_064497381.1 | DUF1127 domain-containing protein | - |
O4J57_RS23720 (O4J57_23715) | 4993573..4994985 | + | 1413 | WP_032697905.1 | PLP-dependent aminotransferase family protein | - |
O4J57_RS23725 (O4J57_23720) | 4995139..4995444 | - | 306 | WP_032689635.1 | BrnA antitoxin family protein | Antitoxin |
O4J57_RS23730 (O4J57_23725) | 4995431..4995718 | - | 288 | WP_278071913.1 | BrnT family toxin | Toxin |
O4J57_RS23735 (O4J57_23730) | 4995960..4996403 | - | 444 | WP_032689637.1 | FosA family fosfomycin resistance glutathione transferase | - |
O4J57_RS23740 (O4J57_23735) | 4996397..4997305 | - | 909 | WP_278071914.1 | LysR family transcriptional regulator | - |
O4J57_RS23745 (O4J57_23740) | 4997393..4998175 | + | 783 | WP_278071915.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11182.62 Da Isoelectric Point: 8.5356
>T266829 WP_278071913.1 NZ_CP114772:c4995718-4995431 [Raoultella planticola]
MPMGFEWYANKATSNLKKHGIRFEEAVLVFDDPQHLSRHDRYENGEYRWQTIELVHGVTVVLVAHSVRFESGTEVIRIIS
ARKADKKERNRYEHG
MPMGFEWYANKATSNLKKHGIRFEEAVLVFDDPQHLSRHDRYENGEYRWQTIELVHGVTVVLVAHSVRFESGTEVIRIIS
ARKADKKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|