Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4433390..4434009 Replicon chromosome
Accession NZ_CP114772
Organism Raoultella planticola strain RP_3045

Toxin (Protein)


Gene name Hha Uniprot ID A0A514EV16
Locus tag O4J57_RS21075 Protein ID WP_004858783.1
Coordinates 4433791..4434009 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A514EV88
Locus tag O4J57_RS21070 Protein ID WP_004858785.1
Coordinates 4433390..4433764 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4J57_RS21060 (O4J57_21055) 4428501..4429694 + 1194 WP_278071132.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
O4J57_RS21065 (O4J57_21060) 4429717..4432863 + 3147 WP_032689204.1 multidrug efflux RND transporter permease subunit AcrB -
O4J57_RS21070 (O4J57_21065) 4433390..4433764 + 375 WP_004858785.1 Hha toxicity modulator TomB Antitoxin
O4J57_RS21075 (O4J57_21070) 4433791..4434009 + 219 WP_004858783.1 HHA domain-containing protein Toxin
O4J57_RS21080 (O4J57_21075) 4434161..4434727 + 567 WP_032689205.1 maltose O-acetyltransferase -
O4J57_RS21085 (O4J57_21080) 4434699..4434833 - 135 WP_223306663.1 hypothetical protein -
O4J57_RS21090 (O4J57_21085) 4434827..4435297 + 471 WP_004858780.1 YlaC family protein -
O4J57_RS21095 (O4J57_21090) 4435272..4436723 - 1452 WP_047664238.1 PLP-dependent aminotransferase family protein -
O4J57_RS21100 (O4J57_21095) 4436825..4437535 + 711 WP_064793190.1 GNAT family protein -
O4J57_RS21105 (O4J57_21100) 4437532..4437672 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
O4J57_RS21110 (O4J57_21105) 4437675..4437935 - 261 WP_032689208.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8570.90 Da        Isoelectric Point: 7.9907

>T266828 WP_004858783.1 NZ_CP114772:4433791-4434009 [Raoultella planticola]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14411.19 Da        Isoelectric Point: 4.8989

>AT266828 WP_004858785.1 NZ_CP114772:4433390-4433764 [Raoultella planticola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A514EV16

Antitoxin

Source ID Structure
AlphaFold DB A0A514EV88

References