Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-StbC
Location 5209480..5210116 Replicon chromosome
Accession NZ_CP114771
Organism Endozoicomonas sp. GU-1 strain Ap1-2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag O3276_RS21725 Protein ID WP_269673182.1
Coordinates 5209700..5210116 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O3276_RS21720 Protein ID WP_269673181.1
Coordinates 5209480..5209713 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3276_RS21695 (O3276_21695) 5204622..5205008 + 387 WP_269673177.1 type II toxin-antitoxin system VapC family toxin -
O3276_RS21700 (O3276_21700) 5205028..5206842 - 1815 WP_269673178.1 anthrax toxin-like adenylyl cyclase domain-containing protein -
O3276_RS21705 (O3276_21705) 5206829..5207059 - 231 WP_269673179.1 hypothetical protein -
O3276_RS21710 (O3276_21710) 5207530..5208954 - 1425 WP_269673180.1 transposase -
O3276_RS21715 (O3276_21715) 5209114..5209369 - 256 Protein_4237 sugar phosphate nucleotidyltransferase -
O3276_RS21720 (O3276_21720) 5209480..5209713 + 234 WP_269673181.1 DNA-binding protein Antitoxin
O3276_RS21725 (O3276_21725) 5209700..5210116 + 417 WP_269673182.1 type II toxin-antitoxin system VapC family toxin Toxin
O3276_RS21730 (O3276_21730) 5210233..5211885 + 1653 WP_269673183.1 IS1634 family transposase -
O3276_RS21735 (O3276_21735) 5211862..5212230 - 369 WP_269673184.1 hypothetical protein -
O3276_RS21740 (O3276_21740) 5212419..5212673 + 255 WP_269673185.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
O3276_RS21745 (O3276_21745) 5212670..5212942 + 273 Protein_4243 Txe/YoeB family addiction module toxin -
O3276_RS21750 (O3276_21750) 5213413..5213655 + 243 WP_269673186.1 DUF6364 family protein -
O3276_RS21755 (O3276_21755) 5213652..5214074 + 423 WP_269673187.1 PIN domain-containing protein -
O3276_RS21760 (O3276_21760) 5214279..5214737 - 459 WP_101746539.1 DUF29 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15760.14 Da        Isoelectric Point: 10.1715

>T266819 WP_269673182.1 NZ_CP114771:5209700-5210116 [Endozoicomonas sp. GU-1]
VYLIDTNVIGEIRKKQKANPGVQGFFKEATQQASPLYLSVITLGDLRRGVEKIRHRGDTPQAKQLEHWLKTLIRDYSQYI
LEFGITEAQIWGKLRVPYENAIEKQIAATAITYGLTLVTRNTRAFINTGVNVLNPFWN

Download         Length: 417 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8448.49 Da        Isoelectric Point: 4.7962

>AT266819 WP_269673181.1 NZ_CP114771:5209480-5209713 [Endozoicomonas sp. GU-1]
VPNLIVRNIDEKIVAALKAQAGKNGLSAEAEHRRILESVLLKPQKKSFTEALKSIPNVGNDDDFERLEDSGDSSVFD

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References