Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ParE-CopA/RHH(antitoxin) |
| Location | 3411520..3412076 | Replicon | chromosome |
| Accession | NZ_CP114771 | ||
| Organism | Endozoicomonas sp. GU-1 strain Ap1-2 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O3276_RS14045 | Protein ID | WP_269671914.1 |
| Coordinates | 3411520..3411816 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | copA | Uniprot ID | - |
| Locus tag | O3276_RS14050 | Protein ID | WP_163369309.1 |
| Coordinates | 3411813..3412076 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3276_RS14015 (O3276_14015) | 3407523..3408272 | - | 750 | WP_269671909.1 | hypothetical protein | - |
| O3276_RS14020 (O3276_14020) | 3408382..3409986 | - | 1605 | WP_269671910.1 | hypothetical protein | - |
| O3276_RS14025 (O3276_14025) | 3409962..3410321 | - | 360 | WP_269671911.1 | hypothetical protein | - |
| O3276_RS14030 (O3276_14030) | 3410324..3410572 | - | 249 | WP_101745988.1 | hypothetical protein | - |
| O3276_RS14035 (O3276_14035) | 3410652..3410984 | - | 333 | WP_269671912.1 | 3TM-type holin | - |
| O3276_RS14040 (O3276_14040) | 3410974..3411372 | - | 399 | WP_269671913.1 | M15 family metallopeptidase | - |
| O3276_RS14045 (O3276_14045) | 3411520..3411816 | - | 297 | WP_269671914.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O3276_RS14050 (O3276_14050) | 3411813..3412076 | - | 264 | WP_163369309.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| O3276_RS14055 (O3276_14055) | 3412132..3412668 | - | 537 | WP_269671915.1 | hypothetical protein | - |
| O3276_RS14060 (O3276_14060) | 3412678..3414033 | - | 1356 | WP_269671916.1 | DNA cytosine methyltransferase | - |
| O3276_RS14065 (O3276_14065) | 3414047..3414529 | - | 483 | WP_269671917.1 | DUF1367 family protein | - |
| O3276_RS14070 (O3276_14070) | 3414618..3415175 | - | 558 | WP_269671918.1 | replication protein P | - |
| O3276_RS14075 (O3276_14075) | 3415126..3416253 | - | 1128 | WP_269671919.1 | hypothetical protein | - |
| O3276_RS14080 (O3276_14080) | 3416250..3416567 | - | 318 | WP_209277157.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3389634..3427688 | 38054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11616.54 Da Isoelectric Point: 9.8890
>T266815 WP_269671914.1 NZ_CP114771:c3411816-3411520 [Endozoicomonas sp. GU-1]
MKLRFSRSAVDDLKRLRQFIAEKNPPAAQRMAEYLVRKINNLCHQPNMGVLVGDKLNPRLRDLIIRDYKIRYLADDREVL
ILKIWHQKEADEISLDSE
MKLRFSRSAVDDLKRLRQFIAEKNPPAAQRMAEYLVRKINNLCHQPNMGVLVGDKLNPRLRDLIIRDYKIRYLADDREVL
ILKIWHQKEADEISLDSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|