Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3392370..3392992 | Replicon | chromosome |
| Accession | NZ_CP114771 | ||
| Organism | Endozoicomonas sp. GU-1 strain Ap1-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O3276_RS13920 | Protein ID | WP_269671893.1 |
| Coordinates | 3392370..3392771 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O3276_RS13925 | Protein ID | WP_269671894.1 |
| Coordinates | 3392771..3392992 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3276_RS13905 (O3276_13905) | 3389052..3389246 | - | 195 | WP_269671891.1 | hypothetical protein | - |
| O3276_RS13910 (O3276_13910) | 3389304..3389399 | - | 96 | WP_269675989.1 | hypothetical protein | - |
| O3276_RS13915 (O3276_13915) | 3389634..3392030 | - | 2397 | WP_269671892.1 | exonuclease domain-containing protein | - |
| O3276_RS13920 (O3276_13920) | 3392370..3392771 | - | 402 | WP_269671893.1 | PIN domain-containing protein | Toxin |
| O3276_RS13925 (O3276_13925) | 3392771..3392992 | - | 222 | WP_269671894.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O3276_RS13930 (O3276_13930) | 3393067..3393390 | + | 324 | WP_269671895.1 | hypothetical protein | - |
| O3276_RS13935 (O3276_13935) | 3393511..3394764 | + | 1254 | WP_269671896.1 | ISL3 family transposase | - |
| O3276_RS13940 (O3276_13940) | 3395209..3395484 | - | 276 | WP_163370563.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O3276_RS13945 (O3276_13945) | 3395481..3395729 | - | 249 | WP_257266787.1 | ribbon-helix-helix protein, CopG family | - |
| O3276_RS13950 (O3276_13950) | 3396115..3396705 | + | 591 | WP_269671897.1 | nucleotidyltransferase domain-containing protein | - |
| O3276_RS13955 (O3276_13955) | 3396702..3396887 | + | 186 | WP_269671898.1 | hypothetical protein | - |
| O3276_RS13960 (O3276_13960) | 3396996..3397397 | - | 402 | WP_269671899.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3389634..3427688 | 38054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14996.04 Da Isoelectric Point: 6.3303
>T266814 WP_269671893.1 NZ_CP114771:c3392771-3392370 [Endozoicomonas sp. GU-1]
MAEYMVDTDICIAVLKHNRPVIDKFIEHQGKVYVSSISCYELQFGIEKGDPEHRQGKESKLSFFLEGVNVIDFDGAAARE
SAKVREELQRGQQIGAYDTLLAAHARSRGMVMVTHNQREFSRVPGLQLADWLG
MAEYMVDTDICIAVLKHNRPVIDKFIEHQGKVYVSSISCYELQFGIEKGDPEHRQGKESKLSFFLEGVNVIDFDGAAARE
SAKVREELQRGQQIGAYDTLLAAHARSRGMVMVTHNQREFSRVPGLQLADWLG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|