Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 2689205..2689688 Replicon chromosome
Accession NZ_CP114771
Organism Endozoicomonas sp. GU-1 strain Ap1-2

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag O3276_RS11110 Protein ID WP_269675677.1
Coordinates 2689205..2689480 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag O3276_RS11115 Protein ID WP_101748923.1
Coordinates 2689467..2689688 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3276_RS11090 (O3276_11090) 2684671..2685702 + 1032 WP_269675674.1 porin -
O3276_RS11095 (O3276_11095) 2686161..2686499 - 339 WP_269675675.1 hypothetical protein -
O3276_RS11100 (O3276_11100) 2686492..2686731 - 240 WP_252023919.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
O3276_RS11105 (O3276_11105) 2687677..2688996 + 1320 WP_269675676.1 group II intron reverse transcriptase/maturase -
O3276_RS11110 (O3276_11110) 2689205..2689480 + 276 WP_269675677.1 BrnT family toxin Toxin
O3276_RS11115 (O3276_11115) 2689467..2689688 + 222 WP_101748923.1 CopG family transcriptional regulator Antitoxin
O3276_RS11120 (O3276_11120) 2689821..2690105 + 285 WP_241693369.1 type II toxin-antitoxin system RelE/ParE family toxin -
O3276_RS11125 (O3276_11125) 2690109..2690387 + 279 WP_269675678.1 putative addiction module antidote protein -
O3276_RS11130 (O3276_11130) 2690448..2690921 - 474 WP_269675679.1 DUF29 domain-containing protein -
O3276_RS11135 (O3276_11135) 2691402..2691725 - 324 WP_269675680.1 iron donor protein CyaY -
O3276_RS11140 (O3276_11140) 2691915..2692079 + 165 WP_269675681.1 lipoprotein -
O3276_RS11145 (O3276_11145) 2692136..2693413 + 1278 WP_269675682.1 diaminopimelate decarboxylase -
O3276_RS11150 (O3276_11150) 2693437..2694268 + 832 Protein_2165 diaminopimelate epimerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(8-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10730.11 Da        Isoelectric Point: 7.1348

>T266812 WP_269675677.1 NZ_CP114771:2689205-2689480 [Endozoicomonas sp. GU-1]
MGNTQFEYDEEKSLANKDKHGIDFVQAATLWEDDRLICLQSKVKTDEDRLLFIGQITTKHWTAIATQRRDCLRIISVRRS
RKNEVNLYESQ

Download         Length: 276 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8435.52 Da        Isoelectric Point: 5.0608

>AT266812 WP_101748923.1 NZ_CP114771:2689467-2689688 [Endozoicomonas sp. GU-1]
MKASDIDKKFDDGEDVLEFFDTDHPQRPNLAAKRVNIDFPAWVVNELDKEASAIGISRQALIKTWIVDRLRQH

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References