Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 2460500..2460939 Replicon chromosome
Accession NZ_CP114771
Organism Endozoicomonas sp. GU-1 strain Ap1-2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag O3276_RS10110 Protein ID WP_269675516.1
Coordinates 2460784..2460939 (+) Length 52 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag O3276_RS10105 Protein ID WP_269675962.1
Coordinates 2460500..2460784 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3276_RS10085 (O3276_10085) 2456310..2457023 - 714 WP_269675513.1 histidine utilization repressor -
O3276_RS10090 (O3276_10090) 2457218..2459137 + 1920 WP_269675514.1 imidazolonepropionase -
O3276_RS10095 (O3276_10095) 2459056..2459436 + 381 WP_269675961.1 arginase family protein -
O3276_RS10100 (O3276_10100) 2459473..2460081 - 609 WP_269675515.1 hypothetical protein -
O3276_RS10105 (O3276_10105) 2460500..2460784 + 285 WP_269675962.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O3276_RS10110 (O3276_10110) 2460784..2460939 + 156 WP_269675516.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O3276_RS10120 (O3276_10120) 2461791..2462270 - 480 WP_101745079.1 SsrA-binding protein SmpB -
O3276_RS10125 (O3276_10125) 2462782..2464140 + 1359 WP_101745080.1 sodium-dependent transporter -
O3276_RS10130 (O3276_10130) 2464227..2464658 + 432 WP_269675517.1 type II toxin-antitoxin system RatA family toxin -
O3276_RS10135 (O3276_10135) 2464651..2464977 + 327 WP_269675518.1 RnfH family protein -
O3276_RS10140 (O3276_10140) 2465019..2465393 - 375 WP_101745082.1 outer membrane protein assembly factor BamE -
O3276_RS10145 (O3276_10145) 2465517..2465924 + 408 WP_219622117.1 ferric iron uptake transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-50)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5944.72 Da        Isoelectric Point: 3.7615

>T266810 WP_269675516.1 NZ_CP114771:2460784-2460939 [Endozoicomonas sp. GU-1]
MILWEEESLNDREKIFEFLYDFNPEAAEKTDLIIETKVENLLEQPLMGGAA

Download         Length: 156 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10971.21 Da        Isoelectric Point: 9.1596

>AT266810 WP_269675962.1 NZ_CP114771:2460500-2460784 [Endozoicomonas sp. GU-1]
METRIQFRVDEETKRLAQKMAESQGRTISDACREFTEQLAEQQRKLSSHDQWLTQQVNQAFEKLDSGATNFAEHDKAKDE
MAKRKAKIRNRGSQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References