Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 270721..271252 | Replicon | chromosome |
| Accession | NZ_CP114771 | ||
| Organism | Endozoicomonas sp. GU-1 strain Ap1-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O3276_RS01280 | Protein ID | WP_163373295.1 |
| Coordinates | 270721..271008 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | O3276_RS01285 | Protein ID | WP_163373296.1 |
| Coordinates | 270998..271252 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3276_RS01245 (O3276_01245) | 266257..266568 | - | 312 | WP_269673999.1 | HigA family addiction module antitoxin | - |
| O3276_RS01250 (O3276_01250) | 266844..267305 | - | 462 | WP_269674000.1 | hypothetical protein | - |
| O3276_RS01255 (O3276_01255) | 267356..267967 | - | 612 | WP_269674001.1 | hypothetical protein | - |
| O3276_RS01260 (O3276_01260) | 268004..268975 | - | 972 | WP_269674002.1 | IS66 family transposase | - |
| O3276_RS01265 (O3276_01265) | 268986..269627 | - | 642 | WP_269674003.1 | transposase | - |
| O3276_RS01270 (O3276_01270) | 269759..270127 | - | 369 | WP_269674004.1 | DUF3768 domain-containing protein | - |
| O3276_RS01275 (O3276_01275) | 270253..270729 | + | 477 | WP_269674005.1 | hypothetical protein | - |
| O3276_RS01280 (O3276_01280) | 270721..271008 | - | 288 | WP_163373295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O3276_RS01285 (O3276_01285) | 270998..271252 | - | 255 | WP_163373296.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O3276_RS01290 (O3276_01290) | 271327..273188 | + | 1862 | Protein_246 | phage terminase large subunit family protein | - |
| O3276_RS01295 (O3276_01295) | 273194..273394 | + | 201 | WP_269674006.1 | hypothetical protein | - |
| O3276_RS01300 (O3276_01300) | 273397..274866 | + | 1470 | WP_269674007.1 | phage portal protein | - |
| O3276_RS01305 (O3276_01305) | 274856..275866 | + | 1011 | WP_269674008.1 | Clp protease ClpP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11271.15 Da Isoelectric Point: 10.6676
>T266807 WP_163373295.1 NZ_CP114771:c271008-270721 [Endozoicomonas sp. GU-1]
MTYELDFSALAWKEWQKLNSTVREQFKAKLRKRLENPKVSKDKLSGQKDCYKIKLRNSGYRLVYQVLDDVVVVFVISVGK
RERSEAYKAAQKRLR
MTYELDFSALAWKEWQKLNSTVREQFKAKLRKRLENPKVSKDKLSGQKDCYKIKLRNSGYRLVYQVLDDVVVVFVISVGK
RERSEAYKAAQKRLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|