Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 102182..102762 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP114768 | ||
| Organism | Hymenobacter canadensis strain PAMC 29467 | ||
Toxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | O3303_RS19785 | Protein ID | WP_269562165.1 |
| Coordinates | 102182..102514 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | O3303_RS19790 | Protein ID | WP_269562166.1 |
| Coordinates | 102502..102762 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3303_RS19765 (O3303_19765) | 98042..99139 | + | 1098 | WP_269562161.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| O3303_RS19770 (O3303_19770) | 99142..100383 | + | 1242 | WP_269562162.1 | FtsX-like permease family protein | - |
| O3303_RS19775 (O3303_19775) | 100387..101064 | + | 678 | WP_269562163.1 | ABC transporter ATP-binding protein | - |
| O3303_RS19780 (O3303_19780) | 101629..101868 | - | 240 | WP_269562164.1 | hypothetical protein | - |
| O3303_RS19785 (O3303_19785) | 102182..102514 | - | 333 | WP_269562165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O3303_RS19790 (O3303_19790) | 102502..102762 | - | 261 | WP_269562166.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| O3303_RS19795 (O3303_19795) | 103088..103678 | + | 591 | WP_269562167.1 | hypothetical protein | - |
| O3303_RS19800 (O3303_19800) | 104040..104354 | - | 315 | WP_269562168.1 | hypothetical protein | - |
| O3303_RS19805 (O3303_19805) | 104351..104599 | - | 249 | WP_269562169.1 | hypothetical protein | - |
| O3303_RS19810 (O3303_19810) | 104806..105612 | - | 807 | WP_269562170.1 | LytTR family DNA-binding domain-containing protein | - |
| O3303_RS19815 (O3303_19815) | 105674..106762 | - | 1089 | WP_269562171.1 | histidine kinase | - |
| O3303_RS19820 (O3303_19820) | 106811..107209 | - | 399 | WP_269562172.1 | STAS/SEC14 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..377776 | 377776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12521.45 Da Isoelectric Point: 9.2419
>T266805 WP_269562165.1 NZ_CP114768:c102514-102182 [Hymenobacter canadensis]
MAVVGVQRFEVWLINLDPTQGSEINKTRPCVVLSPDEMNRYLRTVTIAALTSTRRDYPSRVDCTFQGKEGQVALDHIRSV
DKTRLVRRLGVLPKATAQAVCDRLQEIFQY
MAVVGVQRFEVWLINLDPTQGSEINKTRPCVVLSPDEMNRYLRTVTIAALTSTRRDYPSRVDCTFQGKEGQVALDHIRSV
DKTRLVRRLGVLPKATAQAVCDRLQEIFQY
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|