Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5157000..5157608 | Replicon | chromosome |
Accession | NZ_CP114761 | ||
Organism | Pseudomonas aeruginosa strain NF143349 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | O4M85_RS24205 | Protein ID | WP_016263850.1 |
Coordinates | 5157000..5157347 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | O4M85_RS24210 | Protein ID | WP_003114155.1 |
Coordinates | 5157357..5157608 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4M85_RS24175 (O4M85_24175) | 5152359..5152631 | + | 273 | WP_019725834.1 | cysteine-rich CWC family protein | - |
O4M85_RS24180 (O4M85_24180) | 5152631..5153323 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
O4M85_RS24185 (O4M85_24185) | 5153459..5154502 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
O4M85_RS24190 (O4M85_24190) | 5154582..5155319 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
O4M85_RS24195 (O4M85_24195) | 5155771..5156673 | + | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
O4M85_RS24205 (O4M85_24205) | 5157000..5157347 | - | 348 | WP_016263850.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4M85_RS24210 (O4M85_24210) | 5157357..5157608 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O4M85_RS24215 (O4M85_24215) | 5157822..5158805 | - | 984 | WP_019725833.1 | tyrosine-type recombinase/integrase | - |
O4M85_RS24220 (O4M85_24220) | 5158805..5160097 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
O4M85_RS24225 (O4M85_24225) | 5160356..5161618 | - | 1263 | WP_019725831.1 | zonular occludens toxin domain-containing protein | - |
O4M85_RS24230 (O4M85_24230) | 5161620..5161970 | - | 351 | WP_019725830.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5157000..5179143 | 22143 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13046.85 Da Isoelectric Point: 4.4212
>T266803 WP_016263850.1 NZ_CP114761:c5157347-5157000 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|