Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 147850..148355 | Replicon | chromosome |
Accession | NZ_CP114761 | ||
Organism | Pseudomonas aeruginosa strain NF143349 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | O4M85_RS00665 | Protein ID | WP_003083773.1 |
Coordinates | 147850..148131 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | O4M85_RS00670 | Protein ID | WP_003083775.1 |
Coordinates | 148128..148355 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4M85_RS00640 (O4M85_00640) | 143101..144450 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
O4M85_RS00645 (O4M85_00645) | 144499..145185 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
O4M85_RS00650 (O4M85_00650) | 145286..146020 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
O4M85_RS00655 (O4M85_00655) | 146200..146610 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
O4M85_RS00660 (O4M85_00660) | 146642..147550 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
O4M85_RS00665 (O4M85_00665) | 147850..148131 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
O4M85_RS00670 (O4M85_00670) | 148128..148355 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
O4M85_RS00675 (O4M85_00675) | 148531..149151 | - | 621 | WP_009314940.1 | hypothetical protein | - |
O4M85_RS00680 (O4M85_00680) | 149252..149752 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
O4M85_RS00685 (O4M85_00685) | 149825..150166 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
O4M85_RS00690 (O4M85_00690) | 150248..151675 | - | 1428 | WP_003083784.1 | GABA permease | - |
O4M85_RS00695 (O4M85_00695) | 151844..153337 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T266797 WP_003083773.1 NZ_CP114761:c148131-147850 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|