Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 16484..17592 | Replicon | plasmid pEF0656-3 |
Accession | NZ_CP114620 | ||
Organism | Enterococcus faecium strain EF0656 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | O4N81_RS14975 | Protein ID | WP_000233000.1 |
Coordinates | 16723..17592 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | O4N81_RS14970 | Protein ID | WP_000205227.1 |
Coordinates | 16484..16708 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4N81_RS14950 (O4N81_14950) | 12870..13550 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
O4N81_RS14955 (O4N81_14955) | 13863..14360 | + | 498 | WP_002327635.1 | DNA recombinase | - |
O4N81_RS14960 (O4N81_14960) | 14361..14777 | + | 417 | WP_000323438.1 | recombinase | - |
O4N81_RS14965 (O4N81_14965) | 14779..16341 | + | 1563 | WP_000136908.1 | recombinase family protein | - |
O4N81_RS14970 (O4N81_14970) | 16484..16708 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
O4N81_RS14975 (O4N81_14975) | 16723..17592 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
O4N81_RS14980 (O4N81_14980) | 17573..18307 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
O4N81_RS14985 (O4N81_14985) | 18340..18603 | + | 264 | Protein_20 | aminoglycoside 6-adenylyltransferase | - |
O4N81_RS14990 (O4N81_14990) | 18658..19338 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
O4N81_RS14995 (O4N81_14995) | 19431..20225 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
O4N81_RS15000 (O4N81_15000) | 20318..20860 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
O4N81_RS15005 (O4N81_15005) | 20857..21534 | - | 678 | Protein_24 | aminoglycoside 6-adenylyltransferase | - |
O4N81_RS15010 (O4N81_15010) | 21564..22244 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T266796 WP_000233000.1 NZ_CP114620:16723-17592 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|