Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 35281..36418 | Replicon | plasmid pEF0656-2 |
Accession | NZ_CP114619 | ||
Organism | Enterococcus faecium strain EF0656 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | O4N81_RS14835 | Protein ID | WP_182482948.1 |
Coordinates | 35555..36418 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | O4N81_RS14830 | Protein ID | WP_000301765.1 |
Coordinates | 35281..35553 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4N81_RS14800 (O4N81_14800) | 30285..31724 | + | 1440 | WP_094899393.1 | aminoglycoside O-phosphotransferase APH(2'')-Ia | - |
O4N81_RS14805 (O4N81_14805) | 31854..33026 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
O4N81_RS14810 (O4N81_14810) | 33129..33527 | + | 399 | Protein_35 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
O4N81_RS14815 (O4N81_14815) | 33697..33957 | + | 261 | Protein_36 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
O4N81_RS14820 (O4N81_14820) | 34060..34956 | + | 897 | WP_118215883.1 | ParA family protein | - |
O4N81_RS14825 (O4N81_14825) | 35048..35263 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
O4N81_RS14830 (O4N81_14830) | 35281..35553 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
O4N81_RS14835 (O4N81_14835) | 35555..36418 | + | 864 | WP_182482948.1 | zeta toxin family protein | Toxin |
O4N81_RS14840 (O4N81_14840) | 36855..37172 | + | 318 | WP_002300567.1 | hypothetical protein | - |
O4N81_RS14845 (O4N81_14845) | 37211..37708 | + | 498 | WP_169040278.1 | molecular chaperone DnaJ | - |
O4N81_RS14850 (O4N81_14850) | 37798..37989 | - | 192 | Protein_43 | ISL3 family transposase | - |
O4N81_RS14855 (O4N81_14855) | 38356..38934 | + | 579 | WP_032490934.1 | TetR/AcrR family transcriptional regulator | - |
O4N81_RS14860 (O4N81_14860) | 38966..39409 | + | 444 | WP_032490933.1 | small multi-drug export protein | - |
O4N81_RS14865 (O4N81_14865) | 39562..39747 | + | 186 | WP_169040279.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | VanHAX / aac(6')-aph(2'') | - | 1..45954 | 45954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32432.98 Da Isoelectric Point: 6.6610
>T266795 WP_182482948.1 NZ_CP114619:35555-36418 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISAKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPIPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISAKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPIPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3Q8X | |
PDB | 1GVN | |
AlphaFold DB | A0A829F0A3 |