Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 141564..142083 Replicon plasmid pEF0656-1
Accession NZ_CP114618
Organism Enterococcus faecium strain EF0656

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag O4N81_RS14565 Protein ID WP_000588503.1
Coordinates 141564..141821 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag O4N81_RS14570 Protein ID WP_000388479.1
Coordinates 141814..142083 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4N81_RS14530 (O4N81_14530) 136786..137466 + 681 WP_002331383.1 IS6-like element IS1216 family transposase -
O4N81_RS14535 (O4N81_14535) 137655..138239 - 585 WP_002299575.1 recombinase family protein -
O4N81_RS14540 (O4N81_14540) 138450..138653 - 204 WP_002299573.1 hypothetical protein -
O4N81_RS14545 (O4N81_14545) 138663..139085 - 423 WP_002303116.1 hypothetical protein -
O4N81_RS14550 (O4N81_14550) 139323..139937 + 615 WP_001261742.1 recombinase family protein -
O4N81_RS14555 (O4N81_14555) 140102..140926 - 825 WP_001809248.1 hypothetical protein -
O4N81_RS14560 (O4N81_14560) 140950..141105 - 156 WP_002347142.1 hypothetical protein -
O4N81_RS14565 (O4N81_14565) 141564..141821 - 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
O4N81_RS14570 (O4N81_14570) 141814..142083 - 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O4N81_RS14575 (O4N81_14575) 142214..142393 - 180 WP_001120991.1 hypothetical protein -
O4N81_RS14580 (O4N81_14580) 142409..142609 - 201 WP_002347143.1 hypothetical protein -
O4N81_RS14585 (O4N81_14585) 142774..143481 - 708 WP_002303117.1 hypothetical protein -
O4N81_RS14590 (O4N81_14590) 143474..143911 - 438 WP_002300851.1 hypothetical protein -
O4N81_RS14595 (O4N81_14595) 143926..144177 - 252 WP_002296238.1 hypothetical protein -
O4N81_RS14600 (O4N81_14600) 144177..144383 - 207 WP_002347218.1 hypothetical protein -
O4N81_RS14605 (O4N81_14605) 144820..145080 - 261 WP_002295623.1 hypothetical protein -
O4N81_RS14610 (O4N81_14610) 145254..145358 + 105 WP_008274030.1 putative holin-like toxin -
O4N81_RS14615 (O4N81_14615) 145499..145984 - 486 WP_002303313.1 single-stranded DNA-binding protein -
O4N81_RS14620 (O4N81_14620) 145987..146886 - 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..149649 149649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T266794 WP_000588503.1 NZ_CP114618:c141821-141564 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT266794 WP_000388479.1 NZ_CP114618:c142083-141814 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References