Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 84848..85465 | Replicon | plasmid pEF0656-1 |
| Accession | NZ_CP114618 | ||
| Organism | Enterococcus faecium strain EF0656 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | O4N81_RS14190 | Protein ID | WP_224451579.1 |
| Coordinates | 85313..85465 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | O4N81_RS14185 | Protein ID | WP_002305052.1 |
| Coordinates | 84848..85279 (-) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4N81_RS14170 (O4N81_14170) | 80663..82090 | - | 1428 | WP_002361237.1 | glycoside hydrolase family 32 protein | - |
| O4N81_RS14175 (O4N81_14175) | 82144..83418 | - | 1275 | WP_002323715.1 | MFS transporter | - |
| O4N81_RS14180 (O4N81_14180) | 83721..84674 | + | 954 | WP_002286097.1 | IS30 family transposase | - |
| O4N81_RS14185 (O4N81_14185) | 84848..85279 | - | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| O4N81_RS14190 (O4N81_14190) | 85313..85465 | - | 153 | WP_224451579.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| O4N81_RS14195 (O4N81_14195) | 85559..85738 | - | 180 | Protein_85 | hypothetical protein | - |
| O4N81_RS14200 (O4N81_14200) | 85754..85954 | - | 201 | WP_002324500.1 | hypothetical protein | - |
| O4N81_RS14205 (O4N81_14205) | 86119..86814 | - | 696 | WP_002305050.1 | hypothetical protein | - |
| O4N81_RS14210 (O4N81_14210) | 86807..87004 | - | 198 | Protein_88 | hypothetical protein | - |
| O4N81_RS14215 (O4N81_14215) | 87079..87759 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| O4N81_RS14220 (O4N81_14220) | 87814..87984 | - | 171 | Protein_90 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| O4N81_RS14225 (O4N81_14225) | 87997..88593 | - | 597 | WP_002299811.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
| O4N81_RS14230 (O4N81_14230) | 88674..88823 | - | 150 | WP_002295632.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..149649 | 149649 | |
| - | inside | IScluster/Tn | - | - | 83721..105258 | 21537 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5815.65 Da Isoelectric Point: 10.3560
>T266793 WP_224451579.1 NZ_CP114618:c85465-85313 [Enterococcus faecium]
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 153 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT266793 WP_002305052.1 NZ_CP114618:c85279-84848 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|