Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2284645..2285216 | Replicon | chromosome |
Accession | NZ_CP114617 | ||
Organism | Enterococcus faecium strain EF0656 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | O4N81_RS11235 | Protein ID | WP_105468411.1 |
Coordinates | 2284645..2284986 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | O4N81_RS11240 | Protein ID | WP_002323011.1 |
Coordinates | 2284986..2285216 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4N81_RS11210 (O4N81_11210) | 2279855..2281189 | - | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
O4N81_RS11215 (O4N81_11215) | 2281397..2282227 | + | 831 | WP_002286789.1 | manganese catalase family protein | - |
O4N81_RS11220 (O4N81_11220) | 2282471..2282720 | - | 250 | Protein_2167 | transposase | - |
O4N81_RS11225 (O4N81_11225) | 2282911..2283105 | - | 195 | WP_002297028.1 | hypothetical protein | - |
O4N81_RS11230 (O4N81_11230) | 2283610..2283795 | - | 186 | WP_002304207.1 | hypothetical protein | - |
O4N81_RS11235 (O4N81_11235) | 2284645..2284986 | - | 342 | WP_105468411.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
O4N81_RS11240 (O4N81_11240) | 2284986..2285216 | - | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
O4N81_RS11245 (O4N81_11245) | 2285512..2285850 | + | 339 | WP_002306002.1 | hypothetical protein | - |
O4N81_RS11250 (O4N81_11250) | 2286055..2286630 | - | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
O4N81_RS11255 (O4N81_11255) | 2286995..2287576 | - | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
O4N81_RS11260 (O4N81_11260) | 2287759..2288385 | - | 627 | WP_002352507.1 | cysteine hydrolase | - |
O4N81_RS11265 (O4N81_11265) | 2288407..2289735 | - | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13355.73 Da Isoelectric Point: 10.2170
>T266790 WP_105468411.1 NZ_CP114617:c2284986-2284645 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVIRPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVIRPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|