Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 2071445..2072001 Replicon chromosome
Accession NZ_CP114600
Organism Xanthomonas oryzae pv. oryzae strain LA20

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag O5966_RS09655 Protein ID WP_229001948.1
Coordinates 2071750..2072001 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A854CIX2
Locus tag O5966_RS09650 Protein ID WP_011408759.1
Coordinates 2071445..2071723 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5966_RS09630 (O5966_09630) 2066559..2067116 - 558 WP_011259349.1 DNA-3-methyladenine glycosylase -
O5966_RS09635 (O5966_09635) 2067266..2068234 - 969 WP_269441352.1 IS1595-like element ISXo5 family transposase -
O5966_RS09640 (O5966_09640) 2068815..2069999 + 1185 WP_117231633.1 IS256 family transposase -
O5966_RS09645 (O5966_09645) 2070905..2071249 + 345 WP_198912817.1 hypothetical protein -
O5966_RS09650 (O5966_09650) 2071445..2071723 + 279 WP_011408759.1 CopG family ribbon-helix-helix protein Antitoxin
O5966_RS09655 (O5966_09655) 2071750..2072001 + 252 WP_229001948.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O5966_RS09660 (O5966_09660) 2072078..2072332 + 255 WP_198912806.1 hypothetical protein -
O5966_RS09665 (O5966_09665) 2072325..2072459 + 135 WP_011051575.1 hypothetical protein -
O5966_RS09670 (O5966_09670) 2072528..2072782 + 255 WP_223293127.1 hypothetical protein -
O5966_RS09675 (O5966_09675) 2072999..2073118 + 120 Protein_1853 IS3 family transposase -
O5966_RS09680 (O5966_09680) 2073087..2073215 + 129 WP_012444694.1 hypothetical protein -
O5966_RS09690 (O5966_09690) 2073646..2074047 - 402 WP_011259345.1 H-NS family nucleoid-associated regulatory protein -
O5966_RS09695 (O5966_09695) 2074269..2074445 + 177 Protein_1856 DUF3606 domain-containing protein -
O5966_RS09700 (O5966_09700) 2074727..2075064 + 338 Protein_1857 ATP-dependent DNA ligase -
O5966_RS09705 (O5966_09705) 2075140..2076231 - 1092 WP_041182166.1 ribonuclease D -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-81)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9603.92 Da        Isoelectric Point: 9.9718

>T266787 WP_229001948.1 NZ_CP114600:2071750-2072001 [Xanthomonas oryzae pv. oryzae]
MLRLREFLRPKNPDAARRAGEAIRRGVQALGAHPRMGRLIEDLSEQYREWLIDFGDSGYVARYRFDGDTVTILAVRHQKE
AGY

Download         Length: 252 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10826.11 Da        Isoelectric Point: 4.9736

>AT266787 WP_011408759.1 NZ_CP114600:2071445-2071723 [Xanthomonas oryzae pv. oryzae]
MVTATSIKLDDELKGRVQHLAESRRRTPHWIMREAIEQYVEREEKREALNRDTLKAWDEFQATGLHVTAEEVDKWLASWG
TDDELPPPECHK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A854CIX2

References