Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 3633080..3633611 | Replicon | chromosome |
Accession | NZ_CP114599 | ||
Organism | Phenylobacterium sp. NIBR 498073 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | O4N75_RS18160 | Protein ID | WP_269626852.1 |
Coordinates | 3633321..3633611 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | O4N75_RS18155 | Protein ID | WP_269626851.1 |
Coordinates | 3633080..3633313 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4N75_RS18140 (O4N75_18140) | 3628987..3629904 | + | 918 | WP_269626848.1 | ABC transporter ATP-binding protein | - |
O4N75_RS18145 (O4N75_18145) | 3629954..3631087 | + | 1134 | WP_269626849.1 | ABC transporter permease | - |
O4N75_RS18150 (O4N75_18150) | 3631184..3633007 | + | 1824 | WP_269626850.1 | DUF885 family protein | - |
O4N75_RS18155 (O4N75_18155) | 3633080..3633313 | + | 234 | WP_269626851.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
O4N75_RS18160 (O4N75_18160) | 3633321..3633611 | + | 291 | WP_269626852.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4N75_RS18165 (O4N75_18165) | 3633653..3636187 | + | 2535 | WP_269626853.1 | helicase-related protein | - |
O4N75_RS18170 (O4N75_18170) | 3636184..3636465 | + | 282 | WP_269626854.1 | RNA-binding S4 domain-containing protein | - |
O4N75_RS18175 (O4N75_18175) | 3636487..3637257 | + | 771 | WP_269626855.1 | pseudouridine synthase | - |
O4N75_RS18180 (O4N75_18180) | 3637351..3637770 | + | 420 | WP_269626856.1 | DUF805 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11046.62 Da Isoelectric Point: 7.5179
>T266784 WP_269626852.1 NZ_CP114599:3633321-3633611 [Phenylobacterium sp. NIBR 498073]
MVRYILSPKAKADLSEIWDYGADHWGVDRATDYIRDIQRAIEHAAAHPLRGRACDEVRAGYFKVSVGSHLLFHRLVDDVL
DVVRVLHQRMDVGRHL
MVRYILSPKAKADLSEIWDYGADHWGVDRATDYIRDIQRAIEHAAAHPLRGRACDEVRAGYFKVSVGSHLLFHRLVDDVL
DVVRVLHQRMDVGRHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|