Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 49937..50438 Replicon plasmid pWEC-1
Accession NZ_CP114593
Organism Escherichia coli strain WEC

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag O3296_RS23255 Protein ID WP_000702245.1
Coordinates 50178..50438 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag O3296_RS23250 Protein ID WP_000931278.1
Coordinates 49937..50188 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3296_RS23205 (O3296_23205) 45227..45934 + 708 WP_000108794.1 hypothetical protein -
O3296_RS23210 (O3296_23210) 45954..46094 + 141 Protein_52 hypothetical protein -
O3296_RS23215 (O3296_23215) 46071..46394 + 324 WP_223666488.1 hypothetical protein -
O3296_RS23220 (O3296_23220) 46396..46722 + 327 WP_000206697.1 hypothetical protein -
O3296_RS23225 (O3296_23225) 46982..47281 - 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
O3296_RS23230 (O3296_23230) 47522..47965 + 444 WP_023223351.1 hypothetical protein -
O3296_RS23235 (O3296_23235) 48053..48400 - 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
O3296_RS23240 (O3296_23240) 48397..48645 - 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
O3296_RS23245 (O3296_23245) 49110..49388 - 279 WP_000545937.1 hypothetical protein -
O3296_RS23250 (O3296_23250) 49937..50188 - 252 WP_000931278.1 transcriptional regulator Antitoxin
O3296_RS23255 (O3296_23255) 50178..50438 - 261 WP_000702245.1 hypothetical protein Toxin
O3296_RS23260 (O3296_23260) 50490..50714 - 225 WP_000814383.1 hypothetical protein -
O3296_RS23265 (O3296_23265) 50812..51021 - 210 WP_000866037.1 hypothetical protein -
O3296_RS23270 (O3296_23270) 51062..51385 - 324 WP_000427402.1 hypothetical protein -
O3296_RS23275 (O3296_23275) 51964..52293 - 330 WP_000855121.1 hypothetical protein -
O3296_RS23280 (O3296_23280) 52891..53556 + 666 WP_000532149.1 division plane positioning ATPase MipZ -
O3296_RS23285 (O3296_23285) 53630..53914 + 285 WP_001162371.1 hypothetical protein -
O3296_RS23290 (O3296_23290) 53932..54528 - 597 WP_000125165.1 ProQ/FINO family protein -
O3296_RS23295 (O3296_23295) 54678..54800 - 123 WP_223685802.1 Hok/Gef family protein -
O3296_RS23300 (O3296_23300) 54745..54897 - 153 Protein_70 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..60306 60306
- flank IS/Tn - - 55358..56506 1148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T266778 WP_000702245.1 NZ_CP114593:c50438-50178 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9420.81 Da        Isoelectric Point: 9.8120

>AT266778 WP_000931278.1 NZ_CP114593:c50188-49937 [Escherichia coli]
MLNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References