Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 48053..48645 Replicon plasmid pWEC-1
Accession NZ_CP114593
Organism Escherichia coli strain WEC

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag O3296_RS23240 Protein ID WP_000513532.1
Coordinates 48397..48645 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag O3296_RS23235 Protein ID WP_000681609.1
Coordinates 48053..48400 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3296_RS23190 (O3296_23190) 43344..43685 - 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -
O3296_RS23195 (O3296_23195) 44054..44455 + 402 WP_021575837.1 hypothetical protein -
O3296_RS23200 (O3296_23200) 44473..45225 + 753 WP_000797966.1 conjugal transfer protein TraL -
O3296_RS23205 (O3296_23205) 45227..45934 + 708 WP_000108794.1 hypothetical protein -
O3296_RS23210 (O3296_23210) 45954..46094 + 141 Protein_52 hypothetical protein -
O3296_RS23215 (O3296_23215) 46071..46394 + 324 WP_223666488.1 hypothetical protein -
O3296_RS23220 (O3296_23220) 46396..46722 + 327 WP_000206697.1 hypothetical protein -
O3296_RS23225 (O3296_23225) 46982..47281 - 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
O3296_RS23230 (O3296_23230) 47522..47965 + 444 WP_023223351.1 hypothetical protein -
O3296_RS23235 (O3296_23235) 48053..48400 - 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
O3296_RS23240 (O3296_23240) 48397..48645 - 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
O3296_RS23245 (O3296_23245) 49110..49388 - 279 WP_000545937.1 hypothetical protein -
O3296_RS23250 (O3296_23250) 49937..50188 - 252 WP_000931278.1 transcriptional regulator -
O3296_RS23255 (O3296_23255) 50178..50438 - 261 WP_000702245.1 hypothetical protein -
O3296_RS23260 (O3296_23260) 50490..50714 - 225 WP_000814383.1 hypothetical protein -
O3296_RS23265 (O3296_23265) 50812..51021 - 210 WP_000866037.1 hypothetical protein -
O3296_RS23270 (O3296_23270) 51062..51385 - 324 WP_000427402.1 hypothetical protein -
O3296_RS23275 (O3296_23275) 51964..52293 - 330 WP_000855121.1 hypothetical protein -
O3296_RS23280 (O3296_23280) 52891..53556 + 666 WP_000532149.1 division plane positioning ATPase MipZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..60306 60306


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T266777 WP_000513532.1 NZ_CP114593:c48645-48397 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT266777 WP_000681609.1 NZ_CP114593:c48400-48053 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References