Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4202107..4202702 | Replicon | chromosome |
Accession | NZ_CP114592 | ||
Organism | Escherichia coli strain WEC |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | O3296_RS20240 | Protein ID | WP_000239581.1 |
Coordinates | 4202107..4202457 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | O3296_RS20245 | Protein ID | WP_001223213.1 |
Coordinates | 4202451..4202702 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3296_RS20220 (4197561) | 4197561..4198583 | - | 1023 | WP_063625321.1 | ABC transporter permease | - |
O3296_RS20225 (4198597) | 4198597..4200099 | - | 1503 | WP_063625322.1 | sugar ABC transporter ATP-binding protein | - |
O3296_RS20230 (4200232) | 4200232..4201188 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
O3296_RS20235 (4201498) | 4201498..4202028 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
O3296_RS20240 (4202107) | 4202107..4202457 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
O3296_RS20245 (4202451) | 4202451..4202702 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
O3296_RS20250 (4202914) | 4202914..4203255 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
O3296_RS20255 (4203258) | 4203258..4207037 | - | 3780 | WP_063625323.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T266774 WP_000239581.1 NZ_CP114592:c4202457-4202107 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|