Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3553590..3554427 | Replicon | chromosome |
Accession | NZ_CP114592 | ||
Organism | Escherichia coli strain WEC |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | O3296_RS17320 | Protein ID | WP_000227784.1 |
Coordinates | 3553885..3554427 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | O3296_RS17315 | Protein ID | WP_001297137.1 |
Coordinates | 3553590..3553901 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3296_RS17290 (3548610) | 3548610..3549557 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
O3296_RS17295 (3549579) | 3549579..3551570 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
O3296_RS17300 (3551560) | 3551560..3552174 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
O3296_RS17305 (3552174) | 3552174..3552503 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
O3296_RS17310 (3552515) | 3552515..3553405 | + | 891 | WP_000971336.1 | heme o synthase | - |
O3296_RS17315 (3553590) | 3553590..3553901 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
O3296_RS17320 (3553885) | 3553885..3554427 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
O3296_RS17325 (3554483) | 3554483..3555418 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
O3296_RS17330 (3555826) | 3555826..3557190 | + | 1365 | WP_001000974.1 | MFS transporter | - |
O3296_RS17335 (3557318) | 3557318..3557809 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
O3296_RS17340 (3557977) | 3557977..3558888 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T266771 WP_000227784.1 NZ_CP114592:3553885-3554427 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|