Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2458346..2458984 | Replicon | chromosome |
| Accession | NZ_CP114592 | ||
| Organism | Escherichia coli strain WEC | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | O3296_RS11960 | Protein ID | WP_000813794.1 |
| Coordinates | 2458808..2458984 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O3296_RS11955 | Protein ID | WP_001270286.1 |
| Coordinates | 2458346..2458762 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3296_RS11935 (2453498) | 2453498..2454439 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| O3296_RS11940 (2454440) | 2454440..2455453 | - | 1014 | WP_063625587.1 | ABC transporter ATP-binding protein | - |
| O3296_RS11945 (2455471) | 2455471..2456616 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| O3296_RS11950 (2456861) | 2456861..2458267 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| O3296_RS11955 (2458346) | 2458346..2458762 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| O3296_RS11960 (2458808) | 2458808..2458984 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| O3296_RS11965 (2459206) | 2459206..2459436 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| O3296_RS11970 (2459528) | 2459528..2461489 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| O3296_RS11975 (2461562) | 2461562..2462098 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| O3296_RS11980 (2462190) | 2462190..2463365 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2463405..2464553 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266769 WP_000813794.1 NZ_CP114592:c2458984-2458808 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266769 WP_001270286.1 NZ_CP114592:c2458762-2458346 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|