Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1842690..1843458 | Replicon | chromosome |
| Accession | NZ_CP114592 | ||
| Organism | Escherichia coli strain WEC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O3296_RS08865 | Protein ID | WP_000854814.1 |
| Coordinates | 1842690..1843064 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | O3296_RS08870 | Protein ID | WP_174402693.1 |
| Coordinates | 1843153..1843458 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3296_RS08825 (1838086) | 1838086..1839252 | + | 1167 | WP_085668764.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| O3296_RS08830 (1839371) | 1839371..1839844 | + | 474 | WP_001105393.1 | DNA gyrase inhibitor SbmC | - |
| O3296_RS08835 (1840042) | 1840042..1841100 | + | 1059 | WP_085668766.1 | FUSC family protein | - |
| O3296_RS08840 (1841272) | 1841272..1841601 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| O3296_RS08845 (1841702) | 1841702..1841836 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O3296_RS08850 (1841956) | 1841956..1842084 | + | 129 | Protein_1731 | transposase domain-containing protein | - |
| O3296_RS08855 (1842373) | 1842373..1842453 | - | 81 | Protein_1732 | hypothetical protein | - |
| O3296_RS08860 (1842499) | 1842499..1842693 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O3296_RS08865 (1842690) | 1842690..1843064 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O3296_RS08870 (1843153) | 1843153..1843458 | - | 306 | WP_174402693.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O3296_RS08875 (1843597) | 1843597..1843818 | - | 222 | WP_000692318.1 | DUF987 domain-containing protein | - |
| O3296_RS08880 (1843887) | 1843887..1844363 | - | 477 | WP_001186725.1 | RadC family protein | - |
| O3296_RS08885 (1844379) | 1844379..1844858 | - | 480 | WP_000860087.1 | antirestriction protein | - |
| O3296_RS08890 (1844940) | 1844940..1845758 | - | 819 | WP_001234629.1 | DUF932 domain-containing protein | - |
| O3296_RS08895 (1845858) | 1845858..1846091 | - | 234 | WP_032173243.1 | DUF905 family protein | - |
| O3296_RS08900 (1846170) | 1846170..1846625 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T266764 WP_000854814.1 NZ_CP114592:c1843064-1842690 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|