Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1842690..1843458 Replicon chromosome
Accession NZ_CP114592
Organism Escherichia coli strain WEC

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag O3296_RS08865 Protein ID WP_000854814.1
Coordinates 1842690..1843064 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag O3296_RS08870 Protein ID WP_174402693.1
Coordinates 1843153..1843458 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3296_RS08825 (1838086) 1838086..1839252 + 1167 WP_085668764.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
O3296_RS08830 (1839371) 1839371..1839844 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
O3296_RS08835 (1840042) 1840042..1841100 + 1059 WP_085668766.1 FUSC family protein -
O3296_RS08840 (1841272) 1841272..1841601 + 330 WP_000450409.1 DUF496 family protein -
O3296_RS08845 (1841702) 1841702..1841836 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
O3296_RS08850 (1841956) 1841956..1842084 + 129 Protein_1731 transposase domain-containing protein -
O3296_RS08855 (1842373) 1842373..1842453 - 81 Protein_1732 hypothetical protein -
O3296_RS08860 (1842499) 1842499..1842693 - 195 WP_000988600.1 DUF5983 family protein -
O3296_RS08865 (1842690) 1842690..1843064 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
O3296_RS08870 (1843153) 1843153..1843458 - 306 WP_174402693.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
O3296_RS08875 (1843597) 1843597..1843818 - 222 WP_000692318.1 DUF987 domain-containing protein -
O3296_RS08880 (1843887) 1843887..1844363 - 477 WP_001186725.1 RadC family protein -
O3296_RS08885 (1844379) 1844379..1844858 - 480 WP_000860087.1 antirestriction protein -
O3296_RS08890 (1844940) 1844940..1845758 - 819 WP_001234629.1 DUF932 domain-containing protein -
O3296_RS08895 (1845858) 1845858..1846091 - 234 WP_032173243.1 DUF905 family protein -
O3296_RS08900 (1846170) 1846170..1846625 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T266764 WP_000854814.1 NZ_CP114592:c1843064-1842690 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11294.04 Da        Isoelectric Point: 7.2884

>AT266764 WP_174402693.1 NZ_CP114592:c1843458-1843153 [Escherichia coli]
MPCTVTPFFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References