Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1307467..1308092 | Replicon | chromosome |
Accession | NZ_CP114592 | ||
Organism | Escherichia coli strain WEC |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O3296_RS06405 | Protein ID | WP_000911330.1 |
Coordinates | 1307694..1308092 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | O3296_RS06400 | Protein ID | WP_000450524.1 |
Coordinates | 1307467..1307694 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3296_RS06375 (1303270) | 1303270..1303740 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
O3296_RS06380 (1303740) | 1303740..1304312 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
O3296_RS06385 (1304458) | 1304458..1305336 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
O3296_RS06390 (1305353) | 1305353..1306387 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
O3296_RS06395 (1306600) | 1306600..1307313 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
O3296_RS06400 (1307467) | 1307467..1307694 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
O3296_RS06405 (1307694) | 1307694..1308092 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O3296_RS06410 (1308239) | 1308239..1309102 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
O3296_RS06415 (1309117) | 1309117..1311132 | + | 2016 | WP_000829335.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
O3296_RS06420 (1311206) | 1311206..1311904 | + | 699 | WP_000679812.1 | esterase | - |
O3296_RS06425 (1312014) | 1312014..1312214 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T266762 WP_000911330.1 NZ_CP114592:1307694-1308092 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|