Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876170..876824 | Replicon | chromosome |
Accession | NZ_CP114592 | ||
Organism | Escherichia coli strain WEC |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | O3296_RS04290 | Protein ID | WP_000244772.1 |
Coordinates | 876417..876824 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | O3296_RS04285 | Protein ID | WP_000354046.1 |
Coordinates | 876170..876436 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3296_RS04260 (871458) | 871458..872201 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
O3296_RS04265 (872258) | 872258..873691 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
O3296_RS04270 (873736) | 873736..874047 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
O3296_RS04275 (874211) | 874211..874870 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
O3296_RS04280 (874947) | 874947..875927 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
O3296_RS04285 (876170) | 876170..876436 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
O3296_RS04290 (876417) | 876417..876824 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
O3296_RS04295 (876864) | 876864..877385 | - | 522 | WP_063625410.1 | flavodoxin FldB | - |
O3296_RS04300 (877497) | 877497..878393 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
O3296_RS04305 (878418) | 878418..879128 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O3296_RS04310 (879134) | 879134..880867 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T266759 WP_000244772.1 NZ_CP114592:876417-876824 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |