Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 292276..293076 | Replicon | chromosome |
| Accession | NZ_CP114592 | ||
| Organism | Escherichia coli strain WEC | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | O3296_RS01345 | Protein ID | WP_000342451.1 |
| Coordinates | 292549..293076 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | O3296_RS01340 | Protein ID | WP_001277108.1 |
| Coordinates | 292276..292542 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3296_RS01320 (287934) | 287934..288602 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| O3296_RS01325 (288595) | 288595..289653 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| O3296_RS01330 (289897) | 289897..290751 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| O3296_RS01335 (291023) | 291023..292126 | + | 1104 | WP_078167906.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| O3296_RS01340 (292276) | 292276..292542 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| O3296_RS01345 (292549) | 292549..293076 | + | 528 | WP_000342451.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| O3296_RS01350 (293073) | 293073..293456 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| O3296_RS01355 (293880) | 293880..294989 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| O3296_RS01360 (295037) | 295037..295963 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| O3296_RS01365 (295960) | 295960..297237 | + | 1278 | WP_000803798.1 | branched chain amino acid ABC transporter permease LivM | - |
| O3296_RS01370 (297234) | 297234..298001 | + | 768 | WP_000082110.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19749.73 Da Isoelectric Point: 7.3232
>T266757 WP_000342451.1 NZ_CP114592:292549-293076 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAELPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|