Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 453773..454311 | Replicon | plasmid unnamed |
| Accession | NZ_CP114591 | ||
| Organism | Salinivibrio kushneri strain TGB19 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O4546_RS15100 | Protein ID | WP_077659184.1 |
| Coordinates | 454012..454311 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A2A4GBH9 |
| Locus tag | O4546_RS15095 | Protein ID | WP_069588744.1 |
| Coordinates | 453773..454015 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4546_RS15070 (O4546_15070) | 449220..449927 | + | 708 | WP_269587867.1 | HAD family hydrolase | - |
| O4546_RS15075 (O4546_15075) | 450164..451021 | + | 858 | WP_241831293.1 | metal ABC transporter substrate-binding protein | - |
| O4546_RS15080 (O4546_15080) | 451008..451889 | + | 882 | WP_269587868.1 | ATP-binding cassette domain-containing protein | - |
| O4546_RS15085 (O4546_15085) | 451886..452731 | + | 846 | WP_269587869.1 | metal ABC transporter permease | - |
| O4546_RS15090 (O4546_15090) | 452728..453609 | + | 882 | WP_269587870.1 | metal ABC transporter permease | - |
| O4546_RS15095 (O4546_15095) | 453773..454015 | + | 243 | WP_069588744.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| O4546_RS15100 (O4546_15100) | 454012..454311 | + | 300 | WP_077659184.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4546_RS15105 (O4546_15105) | 454901..455293 | + | 393 | WP_077521791.1 | hypothetical protein | - |
| O4546_RS15110 (O4546_15110) | 455379..456026 | + | 648 | WP_077521789.1 | hypothetical protein | - |
| O4546_RS15115 (O4546_15115) | 456254..456656 | - | 403 | Protein_414 | transposase | - |
| O4546_RS15120 (O4546_15120) | 456748..457458 | + | 711 | WP_269587871.1 | DUF2971 domain-containing protein | - |
| O4546_RS15125 (O4546_15125) | 457497..458018 | + | 522 | WP_269587872.1 | hypothetical protein | - |
| O4546_RS15130 (O4546_15130) | 458017..458127 | + | 111 | Protein_417 | DUF3265 domain-containing protein | - |
| O4546_RS15135 (O4546_15135) | 458222..458917 | - | 696 | WP_269587873.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..607073 | 607073 | |
| - | flank | IS/Tn | - | - | 456321..456656 | 335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11511.45 Da Isoelectric Point: 10.7767
>T266756 WP_077659184.1 NZ_CP114591:454012-454311 [Salinivibrio kushneri]
MKPFTLTIAAKTDLRNIALFTQRRWGKGQRNLYVKRFDDTFWLLAENPDMGKPCDDIRSGYRKFPLGSHIVFYQPKGNHH
IKVVRILHKSMDVNPALGI
MKPFTLTIAAKTDLRNIALFTQRRWGKGQRNLYVKRFDDTFWLLAENPDMGKPCDDIRSGYRKFPLGSHIVFYQPKGNHH
IKVVRILHKSMDVNPALGI
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|