Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 453773..454311 Replicon plasmid unnamed
Accession NZ_CP114591
Organism Salinivibrio kushneri strain TGB19

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag O4546_RS15100 Protein ID WP_077659184.1
Coordinates 454012..454311 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2A4GBH9
Locus tag O4546_RS15095 Protein ID WP_069588744.1
Coordinates 453773..454015 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4546_RS15070 (O4546_15070) 449220..449927 + 708 WP_269587867.1 HAD family hydrolase -
O4546_RS15075 (O4546_15075) 450164..451021 + 858 WP_241831293.1 metal ABC transporter substrate-binding protein -
O4546_RS15080 (O4546_15080) 451008..451889 + 882 WP_269587868.1 ATP-binding cassette domain-containing protein -
O4546_RS15085 (O4546_15085) 451886..452731 + 846 WP_269587869.1 metal ABC transporter permease -
O4546_RS15090 (O4546_15090) 452728..453609 + 882 WP_269587870.1 metal ABC transporter permease -
O4546_RS15095 (O4546_15095) 453773..454015 + 243 WP_069588744.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
O4546_RS15100 (O4546_15100) 454012..454311 + 300 WP_077659184.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4546_RS15105 (O4546_15105) 454901..455293 + 393 WP_077521791.1 hypothetical protein -
O4546_RS15110 (O4546_15110) 455379..456026 + 648 WP_077521789.1 hypothetical protein -
O4546_RS15115 (O4546_15115) 456254..456656 - 403 Protein_414 transposase -
O4546_RS15120 (O4546_15120) 456748..457458 + 711 WP_269587871.1 DUF2971 domain-containing protein -
O4546_RS15125 (O4546_15125) 457497..458018 + 522 WP_269587872.1 hypothetical protein -
O4546_RS15130 (O4546_15130) 458017..458127 + 111 Protein_417 DUF3265 domain-containing protein -
O4546_RS15135 (O4546_15135) 458222..458917 - 696 WP_269587873.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..607073 607073
- flank IS/Tn - - 456321..456656 335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-92)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11511.45 Da        Isoelectric Point: 10.7767

>T266756 WP_077659184.1 NZ_CP114591:454012-454311 [Salinivibrio kushneri]
MKPFTLTIAAKTDLRNIALFTQRRWGKGQRNLYVKRFDDTFWLLAENPDMGKPCDDIRSGYRKFPLGSHIVFYQPKGNHH
IKVVRILHKSMDVNPALGI

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8988.82 Da        Isoelectric Point: 4.0530

>AT266756 WP_069588744.1 NZ_CP114591:453773-454015 [Salinivibrio kushneri]
MAKNTSITLGEHFDGFIASQIETGRYSSTSEVVRAALRLLENQETKLHTLRQLLVEGEQSGDAEYDIDNFIQEIDAEDTQ

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2A4GBH9

References