Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 319916..320564 | Replicon | plasmid unnamed |
| Accession | NZ_CP114587 | ||
| Organism | Salinivibrio kushneri strain TGB4 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | O4598_RS14250 | Protein ID | WP_269601153.1 |
| Coordinates | 320163..320564 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | O4598_RS14245 | Protein ID | WP_077522588.1 |
| Coordinates | 319916..320149 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4598_RS14225 (O4598_14225) | 315308..317755 | + | 2448 | WP_269600700.1 | DUF2309 domain-containing protein | - |
| O4598_RS14230 (O4598_14230) | 317764..318735 | + | 972 | WP_269600702.1 | L-threonylcarbamoyladenylate synthase | - |
| O4598_RS14235 (O4598_14235) | 318746..319156 | - | 411 | WP_269600704.1 | PaaI family thioesterase | - |
| O4598_RS14240 (O4598_14240) | 319149..319661 | - | 513 | WP_269600705.1 | NifB/NifX family molybdenum-iron cluster-binding protein | - |
| O4598_RS14245 (O4598_14245) | 319916..320149 | + | 234 | WP_077522588.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O4598_RS14250 (O4598_14250) | 320163..320564 | + | 402 | WP_269601153.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O4598_RS14255 (O4598_14255) | 320593..320874 | - | 282 | WP_269600708.1 | DUF134 domain-containing protein | - |
| O4598_RS14260 (O4598_14260) | 320988..322436 | - | 1449 | WP_269600709.1 | decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase | - |
| O4598_RS14265 (O4598_14265) | 322448..323173 | - | 726 | WP_269600710.1 | 6-phosphogluconolactonase | - |
| O4598_RS14270 (O4598_14270) | 323170..324672 | - | 1503 | WP_077458389.1 | glucose-6-phosphate dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..562514 | 562514 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14671.08 Da Isoelectric Point: 8.7410
>T266752 WP_269601153.1 NZ_CP114587:320163-320564 [Salinivibrio kushneri]
MLDTCICSFIMREQPKAVLKKLHTVVGNQHRIVISAITYQEMQYGLLGKKASPKHAVLVDAFLQRIDEILPWDKAAVDAT
TAVKRNLMNKGTPIGGNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWAQ
MLDTCICSFIMREQPKAVLKKLHTVVGNQHRIVISAITYQEMQYGLLGKKASPKHAVLVDAFLQRIDEILPWDKAAVDAT
TAVKRNLMNKGTPIGGNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWAQ
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|